DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and PpN58A

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:243 Identity:103/243 - (42%)
Similarity:137/243 - (56%) Gaps:7/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 QPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSVECIFTLF 309
            ||:|::|..|    ..:.||||||:.:|:..||.||.|.: :.||..||:||||..|:|.:..|.
  Fly    62 QPTLLEIPAP----INLLGDIHGQYLNLLRYFESNGYPPD-SVYLLLGDYVDRGKQSIETLTLLL 121

  Fly   310 GFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVMH 374
            ..|..||..|:|.|||||..::|..|||..|...:||..:...|...:|.|||...|.:.|...|
  Fly   122 ALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCH 186

  Fly   375 GGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQ-QWMGLGQSKRGVGIQFGPDVTEKFCK 438
            ||| |....::..||.|.|..:.||.||:|::|||||. :.||.|.::|||...||.||...|..
  Fly   187 GGL-SPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLH 250

  Fly   439 DNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITI 486
            ...|:.|.|.|:|.:.|||.....:.||:|||||||....|.||.:.|
  Fly   251 RFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMCI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 103/243 (42%)
PP2Ac 226..502 CDD:197547 103/243 (42%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 103/243 (42%)
MPP_superfamily 23..311 CDD:301300 103/243 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.