DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:295 Identity:109/295 - (36%)
Similarity:157/295 - (53%) Gaps:37/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LHRKFAYKIL----------CE--------IDTYMRA------QPSLVDITVPDEEKFTICGDIH 266
            ||||....|.          |:        |:...||      :|..::|..|    .|||||||
 Worm    12 LHRKLTNVIFRLTQSWSPGNCQTLFQEKEIIEICYRAREAFWKEPMKLEIEAP----VTICGDIH 72

  Fly   267 GQFYDLMNIFEINGLP--SEKNP---YLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNH 326
            |||.||:::|:|.|.|  |:|:.   |||.||::|||.||:|.|..||.::||:|...||.||||
 Worm    73 GQFEDLLSMFDIYGFPHVSQKDKSSRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNH 137

  Fly   327 ESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCINQKILVMHGGL-FSTEDVTLDHIRR 390
            ||..:|..|||..|...:|:..:.:.|...|..:|||..:..:|:.||||: |..  ::|:.|..
 Worm   138 ESRPVNMQYGFYNECKRRYSVTLYETFQWAFYCMPLCAIVGGRIMCMHGGIPFGL--LSLEQIDE 200

  Fly   391 IERNCQPPEEGLMCELLWSDPQQW-MGLGQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDM 454
            .:|.....:.|:..:|.|:||... :|...|.||.|..||....::|.:...||.|:|:|:|...
 Worm   201 FQRPTDIADVGIPSDLCWADPVSGVVGFQDSPRGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMD 265

  Fly   455 GYEVAHNGKCITVFSAPNYCDTMGNMGAFITITGN 489
            |||...:.|.:|:||||.||....|:||.:.:..|
 Worm   266 GYEFFADKKLVTIFSAPCYCGHFDNLGAVLQVATN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 109/295 (37%)
PP2Ac 226..502 CDD:197547 109/295 (37%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 103/271 (38%)
MPP_superfamily 36..304 CDD:301300 103/271 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.