Sequence 1: | NP_001262433.1 | Gene: | PpD3 / 49779 | FlyBaseID: | FBgn0005777 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956210.1 | Gene: | ppp1cbl / 334597 | ZFINID: | ZDB-GENE-030131-6529 | Length: | 281 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 81/202 - (40%) |
---|---|---|---|
Similarity: | 119/202 - (58%) | Gaps: | 8/202 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 VECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCI 366
Fly 367 NQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDP-QQWMGLGQSKRGVGIQFGP 430
Fly 431 DVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITI------TGN 489
Fly 490 NLKPNYK 496 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PpD3 | NP_001262433.1 | TPR_11 | 49..114 | CDD:290150 | |
TPR_1 | 49..81 | CDD:278916 | |||
TPR repeat | 49..77 | CDD:276809 | |||
TPR repeat | 82..112 | CDD:276809 | |||
MPP_PP5_C | 198..513 | CDD:277362 | 81/202 (40%) | ||
PP2Ac | 226..502 | CDD:197547 | 81/202 (40%) | ||
ppp1cbl | NP_956210.1 | PTZ00480 | 3..254 | CDD:185658 | 80/200 (40%) |
MPP_superfamily | 7..251 | CDD:301300 | 78/197 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |