DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and Pp2B-14D

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster


Alignment Length:346 Identity:124/346 - (35%)
Similarity:182/346 - (52%) Gaps:29/346 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 AVDKPEKTLSEM-YSDMENITIEDDYKGPQLEDGKVTLKFMKELMEHYKAQKRLHRKFAYKILCE 237
            ||:..|:.:..: :.....:|:.:.:   ....||...:.:|   :|:..:.|:....|.||:.:
  Fly    75 AVNTKERVVDSVPFPPSHKLTLAEVF---DQRTGKPNHELLK---QHFILEGRIEEAPALKIIQD 133

  Fly   238 IDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRGSFSV 302
            ....:|.:.:::||..|    .|:||||||||||||.:||:.|.|: ...|||.||:||||.||:
  Fly   134 GAALLRQEKTMIDIEAP----VTVCGDIHGQFYDLMKLFEVGGSPA-STKYLFLGDYVDRGYFSI 193

  Fly   303 ECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIFTQVFNWLPLCHCIN 367
            ||:..|:..|:.||...||.|||||..::.:.:.|..|...||:..:.|.....|:.|||...:|
  Fly   194 ECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMN 258

  Fly   368 QKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMG--------LGQSKRGV 424
            |:.|.:|||| |.|...|:.|||::|..:||..|.||:||||||.:..|        ...|.||.
  Fly   259 QQFLCVHGGL-SPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGC 322

  Fly   425 GIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGK------CITVFSAPNYCDTMGNMGAF 483
            ...:.......|.::|||..|||:||.:|.||.:....:      .||:||||||.|...|..|.
  Fly   323 SYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAV 387

  Fly   484 ITITGNNLKPNYKSFEAVPHP 504
            :....|.:  |.:.|...|||
  Fly   388 LKYENNVM--NIRQFNCSPHP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 120/321 (37%)
PP2Ac 226..502 CDD:197547 112/289 (39%)
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 118/311 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.