DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and T16G12.7

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_499229.1 Gene:T16G12.7 / 188557 WormBaseID:WBGene00011808 Length:319 Species:Caenorhabditis elegans


Alignment Length:262 Identity:92/262 - (35%)
Similarity:143/262 - (54%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 DTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDRG--SFS 301
            |.:|: |.:::::..|    ..||||:|||:.|::.:|:..|.|...| |||.||:||||  |..
 Worm    54 DVFMK-QGAMLELEAP----VKICGDVHGQYSDVLRLFDRGGFPPLVN-YLFLGDYVDRGQQSLE 112

  Fly   302 VECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKY----TSAMADIFTQVFNWLPL 362
            |.|:|  ..:|:.:|.:||:.|||||..::|::|||..||..||    .:.|.:.|...|.::|.
 Worm   113 VACLF--LAYKVKFPGNFFMLRGNHECGSINRVYGFLDEVQRKYGAKGGTTMWNCFQICFAYMPY 175

  Fly   363 CHCINQKILVMHGGLFSTEDVTLDHIRRIERN----CQPPEEGLMCELLWSDPQQWM-GLGQSKR 422
            ...::.:||.||||: |.....|:.:|.::|.    ..|..|   .::|||||...: ....|.|
 Worm   176 TALVSGRILCMHGGI-SKRMNNLNQLRNLQRPVLEVANPSVE---IDILWSDPDSTVDDFVDSTR 236

  Fly   423 GVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITIT 487
            |||..||...........::|.:.|:|:|...|||..:|.:.:|:||||:||....|..|.:.:.
 Worm   237 GVGQVFGAKALTAIMNKLDVDLVARAHQVVQDGYEFFNNKRLVTIFSAPHYCGEFDNAAAMMNVD 301

  Fly   488 GN 489
            .|
 Worm   302 KN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 92/262 (35%)
PP2Ac 226..502 CDD:197547 92/262 (35%)
T16G12.7NP_499229.1 MPP_superfamily 18..313 CDD:301300 92/262 (35%)
PP2Ac 40..313 CDD:197547 92/262 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.