DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and C25A6.1

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_504432.3 Gene:C25A6.1 / 178923 WormBaseID:WBGene00016081 Length:300 Species:Caenorhabditis elegans


Alignment Length:271 Identity:110/271 - (40%)
Similarity:146/271 - (53%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 HRKFAYKILCE----------IDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGL 281
            |.|...:::.|          :|.:.| |.|:|::..|    ..:||||||||.||:.:|...|.
 Worm    19 HEKLLSEVITEGRVLKLLDLALDVFKR-QKSMVEMNAP----IKVCGDIHGQFPDLLRLFHRGGW 78

  Fly   282 PSEKNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYT 346
            |...| |||.||:||||.||:|.|..|..:|:.:|.:.||.|||||...:|::|||..|...:|.
 Worm    79 PPTAN-YLFLGDYVDRGRFSIETIVLLLAYKVKFPGNLFLLRGNHECEFVNKVYGFYEECQKRYQ 142

  Fly   347 SA-MADIFTQVFNWLPLCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSD 410
            |. |...|..||||||||..|..|||.|||||..:.|               .:|.|:.:|||:|
 Worm   143 SVRMFTAFQDVFNWLPLCGLIANKILCMHGGLSPSHD---------------GKERLVADLLWAD 192

  Fly   411 PQQWM-GLGQSKRGVGIQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYC 474
            |...: |..::.||.|..||.|...|.|.|..||.|.|:|:|...|||.....|.:|:||||:||
 Worm   193 PISGLSGFMENNRGAGCGFGRDAVLKVCSDFKLDLICRAHQVVQDGYEFFAGRKLVTIFSAPHYC 257

  Fly   475 DTMGNMGAFIT 485
            ....|..||::
 Worm   258 GQFDNCAAFMS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 110/271 (41%)
PP2Ac 226..502 CDD:197547 110/271 (41%)
C25A6.1NP_504432.3 MPP_superfamily 5..282 CDD:301300 110/271 (41%)
PP2Ac 32..284 CDD:197547 107/258 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.