DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD3 and Ppp6c

DIOPT Version :9

Sequence 1:NP_001262433.1 Gene:PpD3 / 49779 FlyBaseID:FBgn0005777 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_598273.2 Gene:Ppp6c / 171121 RGDID:708460 Length:305 Species:Rattus norvegicus


Alignment Length:272 Identity:115/272 - (42%)
Similarity:155/272 - (56%) Gaps:9/272 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 KILCEIDTYMRAQPSLVDITVPDEEKFTICGDIHGQFYDLMNIFEINGLPSEKNPYLFNGDFVDR 297
            |.||:....:..:.|.|.   |.....|:|||||||||||..:|...|...:.| |:|.||||||
  Rat    25 KRLCDYVCDLLLEESNVQ---PVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTN-YIFMGDFVDR 85

  Fly   298 GSFSVECIFTLFGFKLLYPNHFFLARGNHESINMNQMYGFTGEVTAKYTSAMADIF-TQVFNWLP 361
            |.:|:|....|...|..:|:...|.||||||..:.|:|||..|...||.:|.|..: |:||:.|.
  Rat    86 GYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLT 150

  Fly   362 LCHCINQKILVMHGGLFSTEDVTLDHIRRIERNCQPPEEGLMCELLWSDPQQWMGLGQSKRGVGI 426
            :...|:::||.:|||| |.:..|||.||.||||.:.|.:|..|:|:||||:.......|.||.|.
  Rat   151 VAALIDEQILCVHGGL-SPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGW 214

  Fly   427 QFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYCDTMGNMGAFITITG-NN 490
            .||..||.:|...|||..|.|:|::...||:...:.|.:||:||||||...||:.:.:.... |.
  Rat   215 LFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNT 279

  Fly   491 LKPNYKSFEAVP 502
            .:|  |.|.|||
  Rat   280 REP--KLFRAVP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD3NP_001262433.1 TPR_11 49..114 CDD:290150
TPR_1 49..81 CDD:278916
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
MPP_PP5_C 198..513 CDD:277362 115/272 (42%)
PP2Ac 226..502 CDD:197547 113/270 (42%)
Ppp6cNP_598273.2 MPP_PP2A_PP4_PP6 5..289 CDD:277360 113/270 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.