DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Catr and Vinac1

DIOPT Version :9

Sequence 1:NP_726389.4 Gene:alpha-Catr / 49713 FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001357870.1 Gene:Vinac1 / 668894 MGIID:3649276 Length:1413 Species:Mus musculus


Alignment Length:218 Identity:44/218 - (20%)
Similarity:93/218 - (42%) Gaps:21/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RDMDNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENID--IKGDMYEAAKEARDAGKSIERLCD 79
            :::.|:.:.| ...:...|..|.|.|:.:...:|.::.:  ::.:|...|:....:|::|.|:.:
Mouse    41 KEVQNKALAS-LQKVAEQLANASEEFVHVASRLAGDSEEKWLREEMKPVAESLILSGRNILRVAE 104

  Fly    80 ISPLSGMELRHHIEP--LKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLE 142
                     :.|::|  .:.:..::..|:.:|....::|||.|...|:|..||.......:|.||
Mouse   105 ---------KLHLQPESQRHWEELVATAQQVLVDTKKVLLLDDAAAVRKTRTAANWCLTCVEALE 160

  Fly   143 SVMNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLI 207
            ...:.|....:.......:..|..||.  |.::.:...|     ||..|...:..||.::...|.
Mouse   161 EAEDTTSLRTSLDDLAAALFRLGGLTA--RWAWDQHLGR-----ARHRLGCCVPALLAAAHGHLR 218

  Fly   208 HSDCVIVKENRDTVFCQIRRAMD 230
            |.....:..:|..||...|::::
Mouse   219 HPRDPQLVASRRRVFALTRQSLE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 37/183 (20%)
Vinac1NP_001357870.1 Vinculin 15..>610 CDD:366435 44/218 (20%)
Vinculin <1224..1375 CDD:366435
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.