DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and CK1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_194340.1 Gene:CK1 / 828716 AraportID:AT4G26100 Length:450 Species:Arabidopsis thaliana


Alignment Length:453 Identity:189/453 - (41%)
Similarity:270/453 - (59%) Gaps:53/453 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDG 122
            ||..||:|:|||.|:|||:.||.|::.||.:|||:|.:|:|.|||..|.:.|::|     ....|
plant     5 VGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRIL-----QGGTG 64

  Fly   123 IPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRD 187
            :|.:...|. .|.||.:|::|||.|||||||.|:||.|||:|||:|.|:::|:|:.||:..::||
plant    65 VPNVKWFGV-EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRD 128

  Fly   188 VKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQS 252
            :||:|||:|  ..:|...::||||||||:|.|..|::||||||:|:|||||||.|:|||:|.|||
plant   129 LKPDNFLMG--LGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQS 191

  Fly   253 RRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVR 317
            ||||||:||::.||||:||||||||||.|.|::|::|.:.|.:|.||.||.|:|.|||:|..|.|
plant   192 RRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCR 256

  Fly   318 RLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRHNVTA 382
            .|.|.:.|||.:|:|:|:|||.|:|:..:..||||         .|:.....:.:|..     .|
plant   257 SLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWT---------ILKYQQSQLTAPPS-----RA 307

  Fly   383 KTNAKGGVAAWPDVPKPGATLGNLTPADRHGSVQVVSSTNGELNPDDPTAGHSNTPITQQPEVEV 447
            ...|.|..||.|    ||.:..:....:..|...:.||........|.:...||.|.:......:
plant   308 LNPAVGTSAALP----PGISNIDRYTGEEEGRPHMESSRRRVSGALDNSGNISNQPTSSSARDSM 368

  Fly   448 VDETKCCCFFKRKKKKSTRQKXLDGVQCSPEREAVTLLRATSHSNSRDSVLNNP-SQDYIQQA 509
            :..:.   .|.:....|.                    |.|:.|.|||   |.| |::.:|::
plant   369 IPSSS---LFAQSAGSSR--------------------RVTAVSGSRD---NFPGSEELLQRS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 158/292 (54%)
S_TKc 62..335 CDD:214567 148/272 (54%)
CK1gamma_C 354..428 CDD:289378 13/73 (18%)
CK1NP_194340.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 153/281 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.