DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and AT3G13670

DIOPT Version :10

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_187977.1 Gene:AT3G13670 / 820572 AraportID:AT3G13670 Length:703 Species:Arabidopsis thaliana


Alignment Length:120 Identity:26/120 - (21%)
Similarity:38/120 - (31%) Gaps:50/120 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IADSSYFGPGLSNQVEKIFFNSNPSSECVD---------DGKLFKQCFGDKSIPQFADVVGTLTT 70
            |..|:.||.|            |.:||.:|         .|.:.|.||                 
plant  1167 ITASTSFGDG------------NQTSEKIDVITDEDVPESGPVIKDCF----------------- 1202

  Fly    71 EWLDSSIFVDETRAASKCIRTPTC--NKIKLAKYLMDLIVYRGNKFLAQDSTVSI 123
                     ::|.|:...|..|..  |.| :..|.::|...:||:.|....|..|
plant  1203 ---------NQTSASCLLIWDPPLKPNGI-IRNYSLELYGPQGNQSLCTSDTFII 1247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 13/65 (20%)
CK1gamma_C 354..439 CDD:463640
AT3G13670NP_187977.1 STKc_CK1 137..412 CDD:270918
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.