DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and AT3G13670

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_187977.1 Gene:AT3G13670 / 820572 AraportID:AT3G13670 Length:703 Species:Arabidopsis thaliana


Alignment Length:325 Identity:111/325 - (34%)
Similarity:172/325 - (52%) Gaps:34/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGKSSSNNMYSTRQSVSTTTGV---LMVG--PNFRVGKKIGCGNFGELRLGKNLYNNE------- 86
            |..|..:|..:.::....|...   :.||  |.::|.:|:|.|.||::.:|:.:....       
plant   104 GNDSGGSNKAAAQEEEGNTAPFPERVQVGGSPLYKVERKLGKGGFGQVFVGRRISGGNDRSAGAS 168

  Fly    87 --HVAIKMEPMKSKA-----PQLHLEYRFYKLL-GSHADNAPDGIPRIYHLGTCGGRYNAMVLEL 143
              .||:|.|...||.     |.   |::.|..| |||      |:||::..|. .|.|..||:::
plant   169 ILEVALKFEHRSSKGCNYGPPH---EWQVYNTLGGSH------GVPRVHFKGR-QGDYYVMVMDM 223

  Fly   144 LGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHI 208
            ||.||.||:|...:..|.:.|..||.:.|..:|.:|::..::.||||||||:|:.||.:||.:.:
plant   224 LGPSLWDLWNTSGQAMSSEMVACIAVESLSILEKMHAKGYVHGDVKPENFLLGQPSTSQEKKLFL 288

  Fly   209 IDFGLAKEYIDLDTNRHIPYREHKSL-TGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSL 272
            :|.|||.::.:..:.:|:.|.:...: .||.||.|.:.|:||..|||||||:|.:..::..||.|
plant   289 VDLGLATKWREGGSGQHVEYDQRPDMFRGTVRYASAHAHLGRTASRRDDLESLAYTLIFLHRGRL 353

  Fly   273 PWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDL 337
            ||||.:.|   .:...:...|.||..::||...|..|..:|..|..:.|.|.|:|..|..|||||
plant   354 PWQGYQGD---NKSFLVCKKKMATSPDMLCCFCPPPFKQFLEIVVNMKFDEEPNYGKLVSLFQDL 415

  Fly   338  337
            plant   416  415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 104/293 (35%)
S_TKc 62..335 CDD:214567 100/288 (35%)
CK1gamma_C 354..428 CDD:289378
AT3G13670NP_187977.1 STKc_CK1 137..412 CDD:270918 99/287 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.