DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and AT2G25760

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_973532.1 Gene:AT2G25760 / 817118 AraportID:AT2G25760 Length:676 Species:Arabidopsis thaliana


Alignment Length:380 Identity:123/380 - (32%)
Similarity:180/380 - (47%) Gaps:87/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LMVG--PNFRVGKKIGCGNFGELRLGKNLYNNE----------HVAIKMEPMKSK----APQLHL 104
            :.||  |.:::.:|:|.|.||::.:|:.:..:.          .||:|.|...||    .|.  .
plant    99 VQVGNSPMYKLDRKLGKGGFGQVYVGRKMGTSTSNARFGPGALEVALKFEHRTSKGCNYGPP--Y 161

  Fly   105 EYRFYKLL-GSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIA 168
            |::.|..| |||      |:||::..|..|..| .||:::||.||.|::|...:..|.:.|..||
plant   162 EWQVYNALGGSH------GVPRVHFKGRQGDFY-VMVMDILGPSLWDVWNSTTQAMSTEMVACIA 219

  Fly   169 KQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKS 233
            .:.:..:|.:|||..::.||||||||:|...|..||.:.::|.|||.::.|..|..|:.|.:...
plant   220 IEAISILEKMHSRGYVHGDVKPENFLLGPPGTPEEKKLFLVDLGLASKWRDTATGLHVEYDQRPD 284

  Fly   234 L-TGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKR--- 294
            : .||.||.|::.|:||..|||||||:|.:..::.|||.|||||         || :||||.   
plant   285 VFRGTVRYASVHAHLGRTCSRRDDLESLAYTLVFLLRGRLPWQG---------YQ-VGDTKNKGF 339

  Fly   295 -------ATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT 352
                   ||..|.||...|:.|..::.||..|.|.|.|||    ..:..|||.            
plant   340 LVCKKKMATSPETLCCFCPQPFRQFVEYVVNLKFDEEPDY----AKYVSLFDG------------ 388

  Fly   353 GKTMSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKGGVAAWPDVPKPGATLGNLT 407
                             |:.||.|...:    |.:|   |...:.:.|...|.||
plant   389 -----------------IVGPNPDIRPI----NTEG---AQKLIHQVGQKRGRLT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 109/318 (34%)
S_TKc 62..335 CDD:214567 106/298 (36%)
CK1gamma_C 354..428 CDD:289378 11/54 (20%)
AT2G25760NP_973532.1 STKc_CK1 106..386 CDD:270918 106/302 (35%)
Pkinase 107..366 CDD:278497 98/277 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.