DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and VRK1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_006720310.1 Gene:VRK1 / 7443 HGNCID:12718 Length:420 Species:Homo sapiens


Alignment Length:352 Identity:99/352 - (28%)
Similarity:159/352 - (45%) Gaps:49/352 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ALAGGKSSSNNMYSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHV------A 89
            |...|:.||...:...|.........|....::||..||.|.||.:.|. ::.::|.|      .
Human     6 AAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLA-DMNSSESVGSDAPCV 69

  Fly    90 IKMEPMKSKAPQLHLEYRFYKLLGSHADNAPD--------------GIPRIYHLG---TCGGRYN 137
            :|:||  |....|..|.:||:....     |:              |:|:.:..|   ..|..|.
Human    70 VKVEP--SDNGPLFTELKFYQRAAK-----PEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYR 127

  Fly   138 AMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKR 202
            .|:::..|..|:.::...|::||.||||.::.::|..:||:|....::.|:|..|.|:   :.|.
Human   128 FMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLL---NYKN 189

  Fly   203 EKIIHIIDFGLAKEYIDLDTNRHIPYRE--HKSLTGTARYMSINTHMGREQSRRDDLEALGHMFM 265
            ...::::|:|||..|  .....|..|:|  .:...||..:.||:.|.|...|||.|||.||:..:
Human   190 PDQVYLVDYGLAYRY--CPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMI 252

  Fly   266 YFLRGSLPWQGLKADTLKE-RYQKIGDTKRATPIEVLCD------GHPEEFATYLRYVRRLDFFE 323
            .:|.|.|||:    |.||: :|.:....:....|..|.|      ..|.|.|.|:..|:.||:.|
Human   253 QWLTGHLPWE----DNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTE 313

  Fly   324 TPDYDFLRRLFQDLFDRKGYTDEGEFD 350
            .|.|:.||.:........|..|:|:.|
Human   314 KPLYENLRDILLQGLKAIGSKDDGKLD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 93/322 (29%)
S_TKc 62..335 CDD:214567 89/304 (29%)
CK1gamma_C 354..428 CDD:289378
VRK1XP_006720310.1 STKc_VRK1 26..326 CDD:271024 90/316 (28%)
S_TKc 37..293 CDD:214567 77/272 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.