DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and vrk3

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001013586.1 Gene:vrk3 / 541443 ZFINID:ZDB-GENE-030131-246 Length:459 Species:Danio rerio


Alignment Length:300 Identity:78/300 - (26%)
Similarity:127/300 - (42%) Gaps:75/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LRLGK---NLYN--NEHVAIKMEPMKSKAPQLH-LEYRFYKLLGSHADNAPDGIPRIYHLGTCGG 134
            ||||.   :|:|  |.|:.........|..:|| |::.              |||      :|.|
Zfish   198 LRLGAKEGHLFNEQNFHLRAAKPDAVEKWGKLHKLDFL--------------GIP------SCVG 242

  Fly   135 -----RYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFL 194
                 .|..:|...:|..|:...:......|.|.||.:|.:||..:|::|.:...:.|:...|..
Zfish   243 FGLHETYRFLVFPCMGQPLQTELDEGTGSLSEKNVLQLALRLLDSLEFIHEKEYAHADIHAGNIY 307

  Fly   195 IGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYRE-----HKSLTGTARYMSINTHMGREQSRR 254
            | ::|:..|  :.:..||.|..:  ....:|:.||:     |:   |...::|:::|.|...|||
Zfish   308 I-KSSSHTE--VFLSGFGHAFRF--CPGGKHVEYRQGSRTAHQ---GNISFISLDSHKGAGPSRR 364

  Fly   255 DDLEALGHMFMYFLRGSLPWQGLKADTL-----KERYQKIGDT----------KRATPI--EVLC 302
            .||::||:..:.::.|||||..|..::.     ||||  :.|.          |:|:..  |.||
Zfish   365 SDLQSLGYCMLCWMTGSLPWSHLSHNSSSVAAEKERY--MSDVPGLLTYCYKQKKASSALQEYLC 427

  Fly   303 DGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKG 342
            :            |..|.:.|.|||..|:...|....:.|
Zfish   428 N------------VMALQYTEKPDYTLLKGGLQQSLQKMG 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 77/299 (26%)
S_TKc 62..335 CDD:214567 76/291 (26%)
CK1gamma_C 354..428 CDD:289378
vrk3NP_001013586.1 DUF4758 <9..>104 CDD:292572
PK_VRK3 154..451 CDD:271026 77/294 (26%)
SPS1 236..>384 CDD:223589 44/161 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.