DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and VRK3

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_057524.3 Gene:VRK3 / 51231 HGNCID:18996 Length:474 Species:Homo sapiens


Alignment Length:385 Identity:91/385 - (23%)
Similarity:151/385 - (39%) Gaps:87/385 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRERQASGGGPQTTTAGPSAGNV-------ANATTAL-----------AGGKSSSNNMYSTR--- 46
            |:..|.:.|.||.|:..|.....       :..||:|           ..|:......:.||   
Human   113 RKSPQVTRGSPQKTSCSPQKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQ 177

  Fly    47 ----QSVSTTTGVLMVGP---------NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSK 98
                ::..|:|.....||         :.:.|:.....||.: |..|.|..|:...:...|:.: 
Human   178 GILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGRLFNEQNFFQ-RAAKPLQVNKWKKLYSTPLLA- 240

  Fly    99 APQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARK-FSLK 162
                                    ||.....|....:|..:||..||.||:...::..:. .|.:
Human   241 ------------------------IPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSER 281

  Fly   163 TVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIP 227
            :||.:|.:||..:|::|....::.:|..||..:   ..:.:..:.:..:|.|..|  ..:.:|:.
Human   282 SVLQVACRLLDALEFLHENEYVHGNVTAENIFV---DPEDQSQVTLAGYGFAFRY--CPSGKHVA 341

  Fly   228 YRE-----HKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADT--LKER 285
            |.|     |:   |...::|::.|.|...|||.||::||:..:.:|.|.|||.....:|  :.::
Human   342 YVEGSRSPHE---GDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQ 403

  Fly   286 YQKIGDTKRATPIEVLCDGH----PEEFATYLRYVRRLDFFETPDYDFLRR----LFQDL 337
            .||..|  :..|....| ||    .|....||:.|..|.:.|.|.|..||.    |.|||
Human   404 KQKFVD--KPGPFVGPC-GHWIRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 74/293 (25%)
S_TKc 62..335 CDD:214567 71/288 (25%)
CK1gamma_C 354..428 CDD:289378
VRK3NP_057524.3 zinc_ribbon_2 4..26 CDD:289981
DZR 5..>31 CDD:289539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..152 10/38 (26%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64
DUF4551 <82..>150 CDD:291746 9/36 (25%)
PKc_like 155..457 CDD:304357 77/338 (23%)
SPS1 211..>467 CDD:223589 73/287 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.