DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and Vrk2

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_008768654.1 Gene:Vrk2 / 360991 RGDID:1311585 Length:503 Species:Rattus norvegicus


Alignment Length:426 Identity:115/426 - (26%)
Similarity:167/426 - (39%) Gaps:98/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MVGPNFRVGKKIGCGNFGELRL----GKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSH-- 115
            |.|..:.:||.||.|.||.:.|    .|...:..|| ||:| .:...| |..|.:||:.....  
  Rat    24 MEGNQWALGKMIGSGGFGLIYLAFPTNKPEKDARHV-IKVE-YQENGP-LFSELKFYQRAAKREC 85

  Fly   116 -----ADNAPD--GIPRIYHLGTC---GGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQ 170
                 .....|  |:|..|..|..   |..|..||:|.||:.|:.|.|... .|...|||.:..:
  Rat    86 IQKWVKQRKLDYLGVPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLNQNG-AFKKLTVLQLGIR 149

  Fly   171 LLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYRE--HKS 233
            :|..:||:|....::.|:|..|.|:|..:..|   :::.|:||:..|  .....|..|.|  .|.
  Rat   150 MLDVLEYIHENEYVHGDIKAANLLLGYANPDR---VYLADYGLSYRY--CPNGNHKQYHEDPRKG 209

  Fly   234 LTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPI 298
            ..||..:.|::.|.|...|||.|:|.||:..:.:|.|.|||                :|....|:
  Rat   210 HNGTLEFTSLDAHKGVAPSRRSDVEILGYCMLRWLCGKLPW----------------ETNLENPV 258

  Fly   299 EV------LCDGHPE-------------EFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYT 344
            .|      |.|..||             |.|.:..||..|.:...|||..|:::.     .....
  Rat   259 AVQTAKTKLLDELPESVLKWTTSGSSCRELAEFFMYVHNLAYDAKPDYQKLKKIL-----NPDGV 318

  Fly   345 DEGEFDWT----GKTMSTPVGSLQTGHEVIIS-----------PNKDRHNVTAKTNAKGGVAAW- 393
            ..|..|::    |..|.||:      |..:.|           |.|....|..:|.     |.| 
  Rat   319 PLGPLDFSTKAQGVNMQTPI------HRKVDSPKAIKKPANEFPTKYTRKVCGETR-----ATWR 372

  Fly   394 --PDVPKPGATLGNL-TPAD-RHGSVQVVSSTNGEL 425
              .:..:|...|.:| ||.: |...|:..|.|..|:
  Rat   373 EEQEERRPAVLLSDLATPENSRTRKVREYSDTFSEM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 91/333 (27%)
S_TKc 62..335 CDD:214567 89/309 (29%)
CK1gamma_C 354..428 CDD:289378 21/88 (24%)
Vrk2XP_008768654.1 PKc_like 16..314 CDD:304357 91/319 (29%)
Pkinase 29..290 CDD:278497 81/285 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.