DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and CG7094

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_609851.2 Gene:CG7094 / 35065 FlyBaseID:FBgn0032650 Length:390 Species:Drosophila melanogaster


Alignment Length:382 Identity:156/382 - (40%)
Similarity:218/382 - (57%) Gaps:40/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP 120
            |::|..:|:.|.||.|:||::.||.::.:...||||:|...:|.|||..|.:.|:.|.    ..|
  Fly    21 LLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLA----RCP 81

  Fly   121 DGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIY 185
             |.|.:.|.| |...|||||::|||.|||:|||:|.|:||||||||:..|||.|||.||.|..|:
  Fly    82 -GFPTLLHYG-CEKNYNAMVMDLLGPSLEELFNLCKRRFSLKTVLMLTDQLLMRIECVHERGFIH 144

  Fly   186 RDVKPENFLIG--RTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMG 248
            ||:||:|||:|  |...|    :::|||||:|.|.|:::..|||||..::||||.||.|||..:|
  Fly   145 RDIKPDNFLMGLDRHCNK----LYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIG 205

  Fly   249 REQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYL 313
            .|||||||:|::.:..|||..|.|||||:.|...|::|:||.:.|.:..|..||.|.|.||...:
  Fly   206 VEQSRRDDMESMSYCLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLM 270

  Fly   314 RYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRH 378
            .|||.|.|.|.||:.:||::|:.||....:..:..:|||  .:......:....|.|:  ..:|.
  Fly   271 TYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWT--ALQQQKDQICRSREQIL--ESERE 331

  Fly   379 NVTAKTNAKGGVAAWPDVPKPGATLGNLTPADRH----------GSVQVVSSTNGEL 425
            .|..:...:|   ..|...|           :||          .|.|....:||.|
  Fly   332 EVRKRDGERG---CEPQRDK-----------ERHKDLELDRLHKTSTQQAKCSNGHL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 140/294 (48%)
S_TKc 62..335 CDD:214567 134/274 (49%)
CK1gamma_C 354..428 CDD:289378 14/82 (17%)
CG7094NP_609851.2 STKc_CK1 26..291 CDD:270918 134/274 (49%)
SPS1 26..>266 CDD:223589 122/249 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452703
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D46585at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.