DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and CG9962

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster


Alignment Length:298 Identity:126/298 - (42%)
Similarity:185/298 - (62%) Gaps:14/298 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLG 130
            :|:|.|:||::...|::.:..|||:|:|...:....|.:|...|.|| .|.    .|||..|...
  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLL-RHG----MGIPMTYQFF 78

  Fly   131 TCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLI 195
            : ..|::.:|:||||.|||.||.:|.|:||:|||||:|.|::.|:||:|..|.::||:||||||:
  Fly    79 S-NRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLM 142

  Fly   196 GRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEAL 260
            |...|:..  :|:|||||:|.|.|:..|||:|.|......|||||.|:|....:.||||||||::
  Fly   143 GVGLTRHR--LHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESV 205

  Fly   261 GHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETP 325
            |::.:|.||||||||||..::..::.:.|.:.|.:|....||.|:|.||..|:.|.|:|.|.|.|
  Fly   206 GYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEP 270

  Fly   326 DYDFLRRLFQDLFDRKGYTDEGEFDW------TGKTMS 357
            ||..:|..|..|.....:|::..:||      :||:.|
  Fly   271 DYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 123/293 (42%)
S_TKc 62..335 CDD:214567 118/268 (44%)
CK1gamma_C 354..428 CDD:289378 2/4 (50%)
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 109/247 (44%)
STKc_CK1 17..279 CDD:270918 118/267 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.