DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and hhp1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_595760.1 Gene:hhp1 / 2540718 PomBaseID:SPBC3H7.15 Length:365 Species:Schizosaccharomyces pombe


Alignment Length:365 Identity:182/365 - (49%)
Similarity:240/365 - (65%) Gaps:31/365 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP 120
            |.:|..:|:|:|||.|:||::.||.|:.:.|.||||:|..::|.|||..|||.|::|....    
pombe     5 LRIGNKYRIGRKIGSGSFGDIYLGTNVVSGEEVAIKLESTRAKHPQLEYEYRVYRILSGGV---- 65

  Fly   121 DGIPRIYHLGT-CGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLI 184
             |||.:...|. |.  |||||::|||.|||||||.|.|||||||||::|.||:.|||::||:..:
pombe    66 -GIPFVRWFGVECD--YNAMVMDLLGPSLEDLFNFCNRKFSLKTVLLLADQLISRIEFIHSKSFL 127

  Fly   185 YRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGR 249
            :||:||:|||:|  ..||...::||||||||:|.|..|:.||||||:|:|||||||.|||||:|.
pombe   128 HRDIKPDNFLMG--IGKRGNQVNIIDFGLAKKYRDHKTHLHIPYRENKNLTGTARYASINTHLGI 190

  Fly   250 EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLR 314
            |||||||||:||::.:||.|||||||||||.|.|::|:||.:.|.:||.||||.|.|:||:.||.
pombe   191 EQSRRDDLESLGYVLVYFCRGSLPWQGLKATTKKQKYEKIMEKKISTPTEVLCRGFPQEFSIYLN 255

  Fly   315 YVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT--GKTMSTPVGSLQTGHEVIISP---- 373
            |.|.|.|.:.|||.:||:||:|||.|:.|..:..||||  .||........|...::..:|    
pombe   256 YTRSLRFDDKPDYAYLRKLFRDLFCRQSYEFDYMFDWTLKRKTQQDQQHQQQLQQQLSATPQAIN 320

  Fly   374 ---------NKDRHNVTAKTNAKGG--VAAWPDVPKPGAT 402
                     |..:.|.    :.|||  ....|.:..|.||
pombe   321 PPPERSSFRNYQKQNF----DEKGGDINTTVPVINDPSAT 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 167/295 (57%)
S_TKc 62..335 CDD:214567 157/273 (58%)
CK1gamma_C 354..428 CDD:289378 13/64 (20%)
hhp1NP_595760.1 SPS1 10..335 CDD:223589 172/333 (52%)
STKc_CK1_delta_epsilon 10..284 CDD:271027 162/282 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.