DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and cek1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_588310.1 Gene:cek1 / 2539208 PomBaseID:SPCC1450.11c Length:1338 Species:Schizosaccharomyces pombe


Alignment Length:430 Identity:75/430 - (17%)
Similarity:132/430 - (30%) Gaps:175/430 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGELRLGKNLYNNEHVAIK-MEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIP 124
            ::::.|.|..|.||.:.|.:.....::.||| ::.....|....:..|..:.:......:| .:.
pombe   588 DYKILKPISKGAFGSVYLAQKRTTGDYFAIKILKKSNMIAKNQVINVRAERAILMSQGESP-FVA 651

  Fly   125 RIYHL----------------GTCGGRYNAM-VLELLGLSLEDLFNICARKFSLKTVLMIAKQLL 172
            ::|:.                |.||.....| ||:|..:          |.:..:|||.:..   
pombe   652 KLYYTFQSKDYLYLVMEYLNGGDCGSLLKTMGVLDLDWI----------RTYIAETVLCLGD--- 703

  Fly   173 HRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAK---------------EYIDL-- 220
                 :|.|.:|:||:||||.||.:...     :.:.||||::               ..:||  
pombe   704 -----LHDRGIIHRDIKPENLLISQNGH-----LKLTDFGLSRVGYMKRHRRKQSSSIPVLDLRD 758

  Fly   221 ----------------------------------------------------------------- 220
                                                                             
pombe   759 RSSAISDLSLSTASSVLEAQSLITPERPKRPSLNEKLLSLDGTSIRLAGQSFNYENSAEDSPTAT 823

  Fly   221 ----------------DTNRHIPYREHKS----LTGTARYMSINTHMGREQSRRDDLEALGHMFM 265
                            |:.|..|:.|:|.    ..||..|::....:|....:..|..:||.:..
pombe   824 NTPTSQVDESNIFRSTDSPRVQPFFENKDPSKRFIGTPDYIAPEVILGNPGIKASDWWSLGCVVF 888

  Fly   266 YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEV---------------LCDGHPEEF-ATYLR 314
            .||.|..|:   .|:|..:.:|.|...:...|.||               ||....... |..:.
pombe   889 EFLFGYPPF---NAETPDQVFQNILARRINWPAEVFTAESSVALDLIDRLLCMNPANRLGANGVE 950

  Fly   315 YVRRLDFFETPDYD--------FLRRLFQD----LFDRKG 342
            .::...||::.::|        |:.:.|..    .||.:|
pombe   951 EIKAHPFFKSVNWDTILEEDPPFVPKPFSPEDTVYFDSRG 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 75/430 (17%)
S_TKc 62..335 CDD:214567 71/416 (17%)
CK1gamma_C 354..428 CDD:289378
cek1NP_588310.1 S_TKc 589..958 CDD:214567 67/395 (17%)
STKc_Rim15_like 592..964 CDD:270762 69/398 (17%)
S_TK_X 959..1049 CDD:214529 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.