DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and ZK666.8

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_496261.2 Gene:ZK666.8 / 191385 WormBaseID:WBGene00014048 Length:391 Species:Caenorhabditis elegans


Alignment Length:315 Identity:93/315 - (29%)
Similarity:149/315 - (47%) Gaps:34/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TTTGVLMVGPNFR----VGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSK---APQLHLEYR- 107
            |:|.::.:...||    :...||.|.:||:.|..::...|.||||.||:..|   |.::.||.. 
 Worm    78 TSTPLMPIDEKFRKRWHIEGIIGKGGYGEIYLAIDMKLAEEVAIKAEPLVRKGKIARRMILEQAV 142

  Fly   108 FYKLLGS-HADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNIC-ARKFSLKTVLMIAKQ 170
            ..||.|. |       :|.|:..|.. ..:|.:||:||..:|.|:..:. .||.|..:|..||.|
 Worm   143 LVKLQGKPH-------VPWIFGSGHT-ENFNFIVLQLLSANLGDIRRMSPTRKLSKSSVGRIAVQ 199

  Fly   171 LLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHK--- 232
            .:..:..:|....::||:||.|...|.|| |...::.::||||.:.|.|.|..    :|.|:   
 Worm   200 AIAALRDLHDVGYLHRDIKPGNMCFGITS-KTRHVLMLLDFGLVRRYKDPDGE----WRTHRVKA 259

  Fly   233 SLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLK-ADTLKERYQKIGDTKRAT 296
            ...||.||:|...|...||:..||:.:|.:..:..|.|.|||:.:: :|.:    .|:.|.....
 Worm   260 GFRGTQRYVSTRVHRRLEQTPTDDMVSLLYTLIELLAGELPWRNIENSDAI----WKMKDELHHG 320

  Fly   297 PIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDW 351
            .|:...:. .:|...:.:.|.|||......|..|:...:.|:..|..:|  .:||
 Worm   321 QIDHFHES-SQELIEFSQLVSRLDPMSELPYTTLQASVKKLYLPKKLSD--PYDW 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 91/305 (30%)
S_TKc 62..335 CDD:214567 86/286 (30%)
CK1gamma_C 354..428 CDD:289378
ZK666.8NP_496261.2 PKc_like 92..354 CDD:389743 83/279 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.