DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and ZC373.3

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001257094.1 Gene:ZC373.3 / 191145 WormBaseID:WBGene00013868 Length:321 Species:Caenorhabditis elegans


Alignment Length:276 Identity:70/276 - (25%)
Similarity:130/276 - (47%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YSTRQSVSTTTGV-LMVGPNFRVGK------KIGCGNFGEL-RLGKNLYNNEHVAIKM--EPMKS 97
            |||:|.:...... .::..|.|:.|      |:|.|:|||: :....|..|....:|:  :.:..
 Worm    10 YSTQQKLEIFQFFRRLLAKNNRIAKRYKLIHKVGSGSFGEVWQATDKLEGNVAKIVKIINKYVGG 74

  Fly    98 KAPQLHL---EYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKF 159
            ..|:..|   |..|:|    :..:||: ||.::|..:..| :|.:|:...|.:|.::.......|
 Worm    75 SGPRDILYDNEIEFFK----YCHDAPN-IPTLFHHFSHVG-FNVLVMSEEGQNLREVAKRSPGSF 133

  Fly   160 SLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKRE--KIIHIIDFGLAKEYIDLDT 222
            ||..::.||.|:...:.::|.:..|:||:|.||.|:   |.|.:  |:: :||||.|..:.|::.
 Worm   134 SLNNLIRIAYQIGSTLCFIHDKSFIHRDLKAENVLV---SLKNKVCKMV-LIDFGNAVRFKDVNG 194

  Fly   223 NRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQ 287
            |....:.:....| ...:.|||..:|...::.||..:|.::.:. :.| :.|.....:....:.:
 Worm   195 NELPEFNDGFDYT-HCTHKSINVLLGISHTQNDDWASLVYLLLE-MHG-VTWGSRTGEMFMNKVE 256

  Fly   288 KIGDTKRATPIEVLCD 303
                 ..|.|.|:|.|
 Worm   257 -----FEANPTEILVD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 66/257 (26%)
S_TKc 62..335 CDD:214567 65/256 (25%)
CK1gamma_C 354..428 CDD:289378
ZC373.3NP_001257094.1 PKc_like 35..>236 CDD:389743 56/211 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.