DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and K08H2.5

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001361832.1 Gene:K08H2.5 / 187176 WormBaseID:WBGene00010692 Length:304 Species:Caenorhabditis elegans


Alignment Length:289 Identity:63/289 - (21%)
Similarity:109/289 - (37%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLH---------LEYRFYKLLGSHA 116
            |:::.:.:|.|.:|......:. ::.|..:.:     ||..|.         ||....:.:.:..
 Worm    12 NYKIVEVLGSGEYGTAFACVDA-DSRHSTLAL-----KASNLETIFCENCFKLERTVLQRISTLG 70

  Fly   117 DNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICAR----KFSLKTVLMIAKQLLHRIEY 177
            .|.....|.:............:|:...|.||.|   :|.|    |||...||.|...:...::.
 Worm    71 TNEKSRFPTLVDNFVVDSTLGCLVMTKEGDSLGD---VCKRNDPKKFSPTNVLKIMLSVGKSLQT 132

  Fly   178 VHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKE-------YIDLDTNRHIPYREHKSLT 235
            :||...|:||:...|.|..:|.|.... ..:||:|:.|:       |:.....|.:.::|     
 Worm   133 IHSLGYIHRDIHWNNVLFAKTITPASP-CKLIDYGVGKKFRNRRGNYVKNRPQRDVNFKE----- 191

  Fly   236 GTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKE---------RYQKI-- 289
              ..::|.|..||...:.:||..:|  ||:          |||...:..         |:||:  
 Worm   192 --CGHVSWNVMMGGVPNLKDDFSSL--MFL----------GLKISGISSLEIGSVSEVRHQKMIF 242

  Fly   290 ----GDTKRATP--IEVLC---DGHPEEF 309
                ....|:.|  ::|.|   |...|:|
 Worm   243 ELDPSRFLRSVPWLLKVACVIVDSDAEKF 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 63/289 (22%)
S_TKc 62..335 CDD:214567 62/288 (22%)
CK1gamma_C 354..428 CDD:289378
K08H2.5NP_001361832.1 PKc_like 12..>185 CDD:389743 39/182 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.