DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and F59E12.3

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_495099.2 Gene:F59E12.3 / 186628 WormBaseID:WBGene00019119 Length:141 Species:Caenorhabditis elegans


Alignment Length:158 Identity:38/158 - (24%)
Similarity:58/158 - (36%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NATTALAGGKSSSNNMYSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIK 91
            :.|..||||...:.       |:||.|          :.:||..|:||.:...........:.:|
 Worm     4 STTPFLAGGTELTT-------SISTYT----------INEKIAEGSFGAIFKVTEKSTGTRLVLK 51

  Fly    92 MEPMKSKAPQLHLE-------YRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLE 149
            .|...|.:..|.:|       :|.|             :|.:...|...|. ..:::.|.|.|||
 Worm    52 AELPGSPSNDLRIELVTMLRVFRSY-------------VPEVTDKGVFNGT-KFLIMPLFGKSLE 102

  Fly   150 DLFN-ICARKFSLKTVLMIAKQLLHRIE 176
            |:.. :...|.||.|.:....|.|..||
 Worm   103 DIIGALPGNKCSLSTAIGSLYQCLEAIE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 29/124 (23%)
S_TKc 62..335 CDD:214567 29/123 (24%)
CK1gamma_C 354..428 CDD:289378
F59E12.3NP_495099.2 PKc_like 21..>130 CDD:304357 29/132 (22%)
SPS1 22..>130 CDD:223589 28/131 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.