DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and F39F10.2

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_510731.1 Gene:F39F10.2 / 185497 WormBaseID:WBGene00018202 Length:298 Species:Caenorhabditis elegans


Alignment Length:340 Identity:73/340 - (21%)
Similarity:137/340 - (40%) Gaps:104/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 STRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRF 108
            ||.|.:.          |:.:||.:|.|:||.::|.::..:|                   |.|.
 Worm     2 STMQQIG----------NYTLGKVLGRGSFGSVQLAQDKRSN-------------------EMRV 37

  Fly   109 YKLLGSHADNAPD-----------------GIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICA 156
            .||:....|...|                 |:.:::..|:. ..:|.:|:|.|.   :||..|..
 Worm    38 MKLIRKERDGHRDETWRRETFTLTALSDVSGVTKMFEYGST-ETHNWIVMEQLS---DDLITIVR 98

  Fly   157 RK----FSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEY 217
            |.    ||..|...|..||:..::.:|:..:::.|:|.:|.::...:..|:.:  ::|:||:..:
 Worm    99 RNETKMFSKPTSYQIMWQLVKILQDIHAIGIVHTDIKADNLMVSYKNRVRKLV--LVDYGLSCWF 161

  Fly   218 IDLDTNR-----------HIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALG------HMFM 265
            .|.:.||           |:.:...|:.||       :.||..|     ||..:.      |.||
 Worm   162 KDHNQNRTPPAPFDNRCMHLIHTPAKTATG-------HPHMEAE-----DLVQVAYLSCSLHQFM 214

  Fly   266 YFLRGSLPWQGLKA---DTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDY 327
                   ||:.::|   ..:|:::.|       .|.:.|  |:.::....::.:.:......|||
 Worm   215 -------PWKDVEAPKMTKMKKKFAK-------NPKKYL--GNHQDLKPIIKMLVKQKHGVEPDY 263

  Fly   328 DFLRRLFQDLFDRKG 342
            :.:..|.||:|...|
 Worm   264 EGILDLLQDMFGSLG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 70/323 (22%)
S_TKc 62..335 CDD:214567 65/313 (21%)
CK1gamma_C 354..428 CDD:289378
F39F10.2NP_510731.1 PKc_like 9..271 CDD:389743 66/314 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.