DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and F33D11.7

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_491697.1 Gene:F33D11.7 / 185229 WormBaseID:WBGene00018004 Length:347 Species:Caenorhabditis elegans


Alignment Length:301 Identity:84/301 - (27%)
Similarity:143/301 - (47%) Gaps:15/301 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VGPNFRVGKKIGCG-NFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPD 121
            :|.|::|.|.|... .|..:.:.:::...:..|:|:| .|::|.:: |::..:.||.....|...
 Worm    38 IGKNWKVVKAIQSDKGFNTIYVAEHVQKKKLAAVKVE-RKTEAIKM-LQFELFVLLTVEKKNQCK 100

  Fly   122 GIPRIYHLGTCGGRYNAMVLELLGLSLEDL-FNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIY 185
            ...:::..|. ...||.:.:.|.|.||..| .|....|.::...|.:|:|.|..:|.:|....|:
 Worm   101 QFCKLFEKGN-EKEYNWIAITLCGKSLRALRKNQPKGKLTVACGLSVAQQCLKGLEELHRMGFIH 164

  Fly   186 RDVKPENFLIGRTSTKRE---KIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHM 247
            |:|.|..|.|||.:...:   :.|:|:|||.|.:|::.|.....|........|:.|:|......
 Worm   165 RNVAPSVFAIGRYTGDNQSDMRNIYILDFGFAHQYMNKDGTLKPPSAHPWKYVGSLRHMPRAAFS 229

  Fly   248 GREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATY 312
            ..|.||.:|||...:|.:..::|.|||..||.......|||:  .:....:..:..|.|.||...
 Worm   230 KVEFSRMEDLEMWFYMSVELVKGCLPWAHLKKPKEVHDYQKL--CRNGLQMREMLGGLPPEFFDI 292

  Fly   313 LRYVRRLDFFETPDYDFLRRLFQD--LFDRKGYTDEGEFDW 351
            ::.|.:|.|.:||:|..:..|..:  ||..|   :|..:||
 Worm   293 MQMVDKLSFTDTPNYKEIYGLLTNAILFSGK---NEFPYDW 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 83/298 (28%)
S_TKc 62..335 CDD:214567 76/277 (27%)
CK1gamma_C 354..428 CDD:289378
F33D11.7NP_491697.1 STKc_TTBK 41..315 CDD:270919 77/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.