DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and F22F1.2

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_509374.1 Gene:F22F1.2 / 184850 WormBaseID:WBGene00017714 Length:299 Species:Caenorhabditis elegans


Alignment Length:312 Identity:71/312 - (22%)
Similarity:131/312 - (41%) Gaps:72/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYK---------LLGSHA 116
            |:.:.||:|.|::|::...::..||:...||:         :|.|....:         .|.:.|
 Worm    10 NYILEKKLGEGSYGDVYFCRDERNNKWSVIKL---------IHKEINGVRDETWRRETFALTALA 65

  Fly   117 DNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARK----FSLKTVLMIAKQLLHRIEY 177
            :  ..||.|:|..|.. ..:|.:|:|.|   |:||.||..|.    ||..|...|..||:..::.
 Worm    66 E--VRGISRMYDYGAT-DIHNYIVMEPL---LDDLTNIARRNGIKGFSKSTGFHILWQLVKILQD 124

  Fly   178 VHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNR--------------HIPY 228
            |||..:.:.|:|.:|.:|  :.:.:..::.::||||::.:.|.:.||              |.|.
 Worm   125 VHSFGIAHGDIKADNLMI--SGSNKTFMLSLVDFGLSRSFKDHNGNRTPPIPFPSGCINLIHTPA 187

  Fly   229 REHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQ---GLKADTLKERYQKIG 290
            |               |..|:.....:||..:.:: ....|...||:   |.|...||:.:.:  
 Worm   188 R---------------TANGKPHMEAEDLMQVAYL-ACICRKLAPWEDIDGHKMTKLKKAFAE-- 234

  Fly   291 DTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKG 342
                 .|.:.|  |..::....::.:.:....:.|:|..:..|.|::....|
 Worm   235 -----KPKKFL--GEHQDLKPIIKIIAKQKHGKEPNYKEIMDLLQEMLTSSG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 71/312 (23%)
S_TKc 62..335 CDD:214567 68/302 (23%)
CK1gamma_C 354..428 CDD:289378
F22F1.2NP_509374.1 PKc_like 15..272 CDD:389743 68/298 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.