DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and F10G8.2

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_492648.2 Gene:F10G8.2 / 184323 WormBaseID:WBGene00008662 Length:239 Species:Caenorhabditis elegans


Alignment Length:65 Identity:20/65 - (30%)
Similarity:29/65 - (44%) Gaps:9/65 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TAGPSAGNVANATTALAGGKSSSNNMYSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKN 81
            |..|||||.| |...:|..|.        |||......|...|..:::|..:|.|.:|.:.|.::
 Worm    18 TGTPSAGNAA-AVAPMAHEKD--------RQSKEGDEIVTKSGKKYKLGPVLGEGGYGTVFLSQD 73

  Fly    82  81
             Worm    74  73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 5/21 (24%)
S_TKc 62..335 CDD:214567 5/20 (25%)
CK1gamma_C 354..428 CDD:289378
F10G8.2NP_492648.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.