powered by:
Protein Alignment gish and F10G8.2
DIOPT Version :9
Sequence 1: | NP_001262624.1 |
Gene: | gish / 49701 |
FlyBaseID: | FBgn0250823 |
Length: | 537 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492648.2 |
Gene: | F10G8.2 / 184323 |
WormBaseID: | WBGene00008662 |
Length: | 239 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 29/65 - (44%) |
Gaps: | 9/65 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 TAGPSAGNVANATTALAGGKSSSNNMYSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKN 81
|..|||||.| |...:|..|. |||......|...|..:::|..:|.|.:|.:.|.::
Worm 18 TGTPSAGNAA-AVAPMAHEKD--------RQSKEGDEIVTKSGKKYKLGPVLGEGGYGTVFLSQD 73
Fly 82 81
Worm 74 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160160766 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.