DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and D2024.1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_501151.1 Gene:D2024.1 / 183947 WormBaseID:WBGene00017050 Length:359 Species:Caenorhabditis elegans


Alignment Length:317 Identity:76/317 - (23%)
Similarity:138/317 - (43%) Gaps:73/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FRVGKKIGCGNFGEL-RLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGI-- 123
            ::|.:.||.|.:|:: ::.||.   :..|:|:||                   :..|..|..|  
 Worm    25 YQVVESIGDGAYGQVFKVSKNA---KKYAMKVEP-------------------NRLDGGPASITK 67

  Fly   124 ------------PRIYHLGTCGGR---YNAMVLELLGLSLEDL-FNICARKFSLK-TVLMIAKQL 171
                        .:.:.:...|||   ::.:|:.|||.:|:.| ...|..|.... |...|..|.
 Worm    68 EIEVMMELNNRGAKFFPIFETGGREPKFHMVVMTLLGENLQVLRMKGCNPKACTPGTWSRIGIQC 132

  Fly   172 LHRIEYVHSRHLIYRDVKPENFLIGRT-STKREKIIHIIDFGLAKEYIDLDTNRHI--------- 226
            |..::.:|....::.|:||.||:.|:: .....::.::||||::.::|     |||         
 Worm   133 LFVVKQMHDCGFLHHDLKPANFVWGQSDEVLTSRVFYLIDFGISSKFI-----RHIKGTPINQQN 192

  Fly   227 --PYR-EHK---SLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKER 285
              .:| |:|   ||.||.:|.|...|...:..|.||..:|.:|....:: .|||:.|:|..|:: 
 Worm   193 GFEFRTENKKVHSLVGTPKYTSPKAHAMADLGRGDDFWSLMYMIAELVK-PLPWEILEAKMLEK- 255

  Fly   286 YQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKG 342
                  ||..:.::.|..  .:.|......::...|...|:|:.:...|:|:|.:.|
 Worm   256 ------TKLKSKLKDLYG--IDAFGKIETMLQACTFHSFPNYEMIYHAFKDVFTKSG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 76/317 (24%)
S_TKc 62..335 CDD:214567 72/308 (23%)
CK1gamma_C 354..428 CDD:289378
D2024.1NP_501151.1 PKc_like 25..297 CDD:389743 72/308 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160817
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.