DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C55B7.10

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_491873.4 Gene:C55B7.10 / 183845 WormBaseID:WBGene00016946 Length:369 Species:Caenorhabditis elegans


Alignment Length:358 Identity:103/358 - (28%)
Similarity:162/358 - (45%) Gaps:29/358 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GGPQTTTAGPSAGNVANATTALAGGKSSSNNMYSTRQSVSTTTGVLMVGPNFRVGKKIGCGNFGE 75
            |.|....|..:|||.|    |:|......:.:......:.|..     |..:::|..:|.|.:|.
 Worm    19 GTPSAACAANAAGNAA----AVAPMAPEKDRLPKEGDEIVTEP-----GKKYKLGPVLGDGGYGT 74

  Fly    76 LRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMV 140
            :.|.::  ::..:|:|.|  |....||.:|  ...|..:...|... ...:...||.|..::.|:
 Worm    75 VFLSQD--DDIKIAVKTE--KFSKSQLKIE--IVVLKAAMQANCKH-FCELVDCGTKGKDFDYMM 132

  Fly   141 LELLGLSLEDL-FNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREK 204
            :.|||..|..| ..:..||||:.|.|.|..|.|...|.:|....:.|||||.||..|..|.::.:
 Worm   133 ITLLGKDLHKLRCELPGRKFSINTALRIGIQTLKACEELHRIGFVSRDVKPGNFAPGVKSNRQSR 197

  Fly   205 IIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLR 269
            .|.:.|||||::||| ..|:.||.|:.....||.||.|:|.|...:..||||||:..:..:...|
 Worm   198 TIFMYDFGLARKYID-KNNQVIPTRKEVGWRGTTRYGSLNAHKRLDLGRRDDLESWFYGLVEMTR 261

  Fly   270 GSLPWQGL----KADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFL 330
            |:|||:.:    .....||.....|.|      :.|.: .|.::......|....|...|||..:
 Worm   262 GTLPWRNVVDRSSVQRAKEASHNTGRT------QFLFE-TPSQYDKIFTIVDSYAFESAPDYKQI 319

  Fly   331 RRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSL 363
            .:|..:..:.:...|...:||..:|:||.:.::
 Worm   320 NKLLVEAREERQLRDREHWDWEDETVSTTITTI 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 89/297 (30%)
S_TKc 62..335 CDD:214567 86/277 (31%)
CK1gamma_C 354..428 CDD:289378 3/10 (30%)
C55B7.10NP_491873.4 PKc_like 60..323 CDD:389743 85/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.