DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C44C10.7

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_509953.1 Gene:C44C10.7 / 183456 WormBaseID:WBGene00008088 Length:341 Species:Caenorhabditis elegans


Alignment Length:225 Identity:50/225 - (22%)
Similarity:84/225 - (37%) Gaps:56/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGEL--------RLG--------------KNLYNNEHVAIKMEPMKSKAPQLH 103
            |:.:...:|.|.||.:        ||.              :|.|..|.:.::.....|:..|. 
 Worm    50 NYEIISVLGGGAFGTVYSCVDVDDRLNQLAIKAMDLSTVTRENSYKLELMVLQRVETLSEVEQT- 113

  Fly   104 LEYRFYKLLGSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLF--NICARKFSLKTVLM 166
               ||.||:|:...::..|...::..|.|               :::::  |...| ||...||.
 Worm   114 ---RFSKLIGNFIQDSSLGFFVMHKEGEC---------------VDEVWMRNKSGR-FSASNVLK 159

  Fly   167 IAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRH-----I 226
            |...:.|.:..:|....|:||....|.|.....|.... :.|:|||:.:.:    .||.     .
 Worm   160 IVHCMAHGLRSLHKIGFIHRDCHAGNILFASRLTPTAP-VKIVDFGIGRRF----ANRRGHPIPS 219

  Fly   227 PYREHKSLTGTARYMSINTHMGREQSRRDD 256
            |.|:...|  ...:.|:|.|:|.....:||
 Worm   220 PSRDIDFL--GCEHCSVNVHVGGIPGPKDD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 50/225 (22%)
S_TKc 62..335 CDD:214567 49/224 (22%)
CK1gamma_C 354..428 CDD:289378
C44C10.7NP_509953.1 PKc_like 50..>250 CDD:389743 50/225 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160804
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.