DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C25H3.1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001379695.1 Gene:C25H3.1 / 182922 WormBaseID:WBGene00016111 Length:211 Species:Caenorhabditis elegans


Alignment Length:207 Identity:53/207 - (25%)
Similarity:106/207 - (51%) Gaps:23/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FRVGKKIGCGNFG------ELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP 120
            ::|.|.:|.|::|      ||:.|      :..|:|.|....|.|.|..|.:..|.:.:.:.   
 Worm    19 YKVTKLLGGGSYGCVHEVIELKTG------DRYAMKSEYSSMKKPILLNELKVMKAIYTFSS--- 74

  Fly   121 DGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIY 185
            ..:.::..:|..|.. ..:::::|..:::::|.:.....:|.|.:..:.|.|..:|::|....::
 Worm    75 QHVLKVRDMGVHGST-KFIIMQMLEKNMDEVFELLGGSMTLNTAVATSYQCLEGLEFMHWAGFLH 138

  Fly   186 RDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLT---GTARYMSINTHM 247
            ||:||.|:.:...|.:..:.|:|||:|:.|.::|   |.:: .|:.:.:|   ||..:..|.:|.
 Worm   139 RDIKPNNYCLDANSGQGLRTIYIIDYGICKRFVD---NNNV-IRQPRKITKFRGTLDFAPIVSHE 199

  Fly   248 GREQSRRDDLEA 259
            .||.||..|||:
 Worm   200 LREHSRGSDLES 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 53/207 (26%)
S_TKc 62..335 CDD:214567 53/207 (26%)
CK1gamma_C 354..428 CDD:289378
C25H3.1NP_001379695.1 PKc_like 18..>211 CDD:419665 52/205 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.