Sequence 1: | NP_001262624.1 | Gene: | gish / 49701 | FlyBaseID: | FBgn0250823 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001379695.1 | Gene: | C25H3.1 / 182922 | WormBaseID: | WBGene00016111 | Length: | 211 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 53/207 - (25%) |
---|---|---|---|
Similarity: | 106/207 - (51%) | Gaps: | 23/207 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 FRVGKKIGCGNFG------ELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP 120
Fly 121 DGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIY 185
Fly 186 RDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLT---GTARYMSINTHM 247
Fly 248 GREQSRRDDLEA 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gish | NP_001262624.1 | STKc_CK1_gamma | 61..354 | CDD:271028 | 53/207 (26%) |
S_TKc | 62..335 | CDD:214567 | 53/207 (26%) | ||
CK1gamma_C | 354..428 | CDD:289378 | |||
C25H3.1 | NP_001379695.1 | PKc_like | 18..>211 | CDD:419665 | 52/205 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160160792 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1164 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |