DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C17C3.11

DIOPT Version :10

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001370446.1 Gene:C17C3.11 / 182720 WormBaseID:WBGene00015893 Length:161 Species:Caenorhabditis elegans


Alignment Length:124 Identity:29/124 - (23%)
Similarity:55/124 - (44%) Gaps:25/124 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGIPRI 126
            ::|.||:..|.||.:...::....||| :|.:....:...|.:|   ..::...::.:|..:|.:
 Worm    18 YKVFKKLEDGEFGAVYAVRDDAGEEHV-LKAQLNTKEIYSLRIE---LCVMTKVSEKSPSHMPTL 78

  Fly   127 YHLGTCGGRYNAMVLELLGLSLED----------LFNIC----------ARKFSLKTVL 165
            ...|. ...:|.:|::|||.||:|          .|.:|          ..:|:|:.||
 Worm    79 IDKGR-HDNFNYIVMKLLGKSLQDAIKTGPDGHLTFGLCDWGIVSMLGSIGRFALEWVL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 29/124 (23%)
CK1gamma_C 354..439 CDD:463640
C17C3.11NP_001370446.1 Protein Kinases, catalytic domain 17..>112 CDD:473864 23/98 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.