DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C03C10.2

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_497820.2 Gene:C03C10.2 / 182156 WormBaseID:WBGene00007269 Length:341 Species:Caenorhabditis elegans


Alignment Length:307 Identity:82/307 - (26%)
Similarity:146/307 - (47%) Gaps:54/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IGCGNFGELRLGKNLYNNEHVAIKMEPMKSKA----PQLHLEYR-FYKLLG-SHADNAPDGIPRI 126
            ||.|.:|::.:..::..|:..|:|:|| |.:|    .::.:|.: ..|:.| :|       ||.:
 Worm    56 IGNGGYGQIFMVMDVKKNDERAMKIEP-KLRAEVITKRMIMEQQVLMKMQGKTH-------IPTM 112

  Fly   127 YHLGTCGGRYNAMVLELLGLSLEDLFNICARK------FSLKTVLMIAKQLLHRIEYVHSRHLIY 185
            |..| ...::|.::::||.:::.|.     ||      .|.:||..||.|.|:.::.:|....::
 Worm   113 YASG-FNDQFNFIIMQLLSMNVGDF-----RKRSPLGRLSKETVGRIAYQTLNALKDIHDMGYVH 171

  Fly   186 RDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGRE 250
            |||||.|...|..:..|. |::::||||.:.: ..::...||:|.:....||.||:|:..|...|
 Worm   172 RDVKPANICFGVHAQNRH-ILYLLDFGLVRRF-KTESGVCIPWRINAGFKGTERYVSVRVHEKLE 234

  Fly   251 QSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHP-EEFATYLR 314
            |:..||..::.:.....:.|.|||:.|      |...:|...|:... ||..:|.. ::.|:.| 
 Worm   235 QTPWDDAFSVLYTAYELVVGELPWRYL------EDIHEIHGVKKLMN-EVTKNGEMFKDIASIL- 291

  Fly   315 YVRRLDF----------FETPDYDFLRRLFQDLFDRKGYTDEGEFDW 351
                :||          .|.| |:.|....:.|:..|...:  .:||
 Worm   292 ----VDFHKMILECDPVVELP-YEKLLECLKCLYSPKSLLE--PYDW 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 82/307 (27%)
S_TKc 62..335 CDD:214567 78/289 (27%)
CK1gamma_C 354..428 CDD:289378
C03C10.2NP_497820.2 PKc_like 49..317 CDD:304357 78/289 (27%)
Pkinase 50..303 CDD:278497 74/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.