DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and ttbk-7

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_506224.1 Gene:ttbk-7 / 179768 WormBaseID:WBGene00011283 Length:776 Species:Caenorhabditis elegans


Alignment Length:401 Identity:111/401 - (27%)
Similarity:184/401 - (45%) Gaps:68/401 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 STTTG-VLMVG----PNFRVGKKIGCGNFGELRLGKNLYN-NEHVAIKMEPMKSKAPQLHLEYRF 108
            |::.| :|.||    ..:::..|||.|.|||:....::.| :|.||||:|..|:....|.:|...
 Worm     3 SSSEGEILQVGQVIRERWKIKAKIGGGGFGEIYEATDVQNHHERVAIKVESSKATKQVLKMEVAV 67

  Fly   109 YKLL--GSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARK-FSLKTVLMIAKQ 170
            .:.|  ..||       .:.|..|. ..::|.:|:.|.|.:|.||.....:: |:|.|.:.:..|
 Worm    68 LRRLQGKKHA-------CKFYGCGR-NDKFNYLVMSLQGKNLADLRREAPKQCFNLSTAVRVGIQ 124

  Fly   171 LLHRIEYVHSRHLIYRDVKPENFLIGRTS-TKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSL 234
            :|:.|..:||...::|||||.||.:|||| |.|.  ::::|||||::|::.......| |.....
 Worm   125 ILNGIREIHSIGFLHRDVKPSNFAMGRTSQTMRN--VYMLDFGLARQYLNAKGEIRSP-RSAAGF 186

  Fly   235 TGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIE 299
            .||.||.::..|..:|..|:|||.:|.:|...||:|.|||:.:|..      .::|..|....:.
 Worm   187 RGTVRYAAVTAHKNKEMGRQDDLWSLFYMLTEFLQGQLPWRKIKDK------DEVGKMKEEADLV 245

  Fly   300 VLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQ 364
            ||.|..|.|...::.:::.|.:.:||||.:|..|...:......:.:..:||            :
 Worm   246 VLLDDCPHEMHLFVAHLKVLGYADTPDYVYLESLLNKIVAENEISWDEPYDW------------E 298

  Fly   365 TGHEVIISPNKDRHNVTAKTNAKGGVAAWPDVPKPGATLGNLTPADRHGSVQVVSSTNGELNPDD 429
            .|::.:.:..|.:.|                        |||:...:..:..|:.....|....|
 Worm   299 LGYDNMATRQKQQAN------------------------GNLSARLKSHTTAVIKDQRNENRALD 339

  Fly   430 PTAGHSNTPIT 440
            ..|     |||
 Worm   340 TQA-----PIT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 93/297 (31%)
S_TKc 62..335 CDD:214567 91/277 (33%)
CK1gamma_C 354..428 CDD:289378 8/73 (11%)
ttbk-7NP_506224.1 STKc_TTBK 19..281 CDD:270919 91/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.