DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and F38E1.3

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_505159.1 Gene:F38E1.3 / 179220 WormBaseID:WBGene00018178 Length:310 Species:Caenorhabditis elegans


Alignment Length:332 Identity:81/332 - (24%)
Similarity:135/332 - (40%) Gaps:67/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAP-QLHLEYRFYKLLGS 114
            |.|.:.....|:.:.|.:|.|.||.:...|:.......|:|:|..:.|.| :|.:|....||:  
 Worm    14 TNTEISSKKANYVIDKLLGEGGFGAVYKVKDSKTGNFYAMKVEKKQEKKPSKLKMEIMILKLV-- 76

  Fly   115 HADNAPDGIPRIYHLGTCGGRYNA------------------MVLELLGLSLEDLFNICARKFSL 161
                             |..|..:                  :|:||.|.||.||.....:.|:.
 Worm    77 -----------------CNERQTSHFTKIIDRGKKDKEGFFFLVMELAGSSLADLKRNRGKAFTC 124

  Fly   162 KTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHI 226
            .|.|.:::|.|...|.:|....|:||:||.||..|  :..::..|:|:|||:::..|:.......
 Worm   125 PTGLSVSQQCLEACEDLHKHGFIHRDLKPANFACG--ADDKQHTIYILDFGISRRIINNQNKLKT 187

  Fly   227 PYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFM-YFLRGSLPWQGLK-ADTL------- 282
            | |......||.::.|::.|.|.|...:||.|:..:|.: ..:...|.|:|.. .||:       
 Worm   188 P-RVTIRFKGTLKFASLSCHKGIEMGWKDDCESWFYMLLDLIVPFGLVWRGANDKDTVCKLKEEA 251

  Fly   283 ---KERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYT 344
               ||.:|.|           .|.   .|....:.|:.:|.:.:..||.::.:...|..|..|..
 Worm   252 RGKKEMFQGI-----------KCG---VELNKIIVYIDKLQYQDHVDYQYIYKTLVDACDTCGGN 302

  Fly   345 DEGEFDW 351
            .:..:||
 Worm   303 MDAPYDW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 79/322 (25%)
S_TKc 62..335 CDD:214567 73/303 (24%)
CK1gamma_C 354..428 CDD:289378
F38E1.3NP_505159.1 PKc_like 24..292 CDD:389743 74/303 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.