DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C27D8.1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_502428.1 Gene:C27D8.1 / 178226 WormBaseID:WBGene00007777 Length:327 Species:Caenorhabditis elegans


Alignment Length:319 Identity:87/319 - (27%)
Similarity:146/319 - (45%) Gaps:34/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPM--KSKAPQLHLEYRFYKLLGS--HADNAPD 121
            |:.|.:.:|.|.||.:.|.::..:.:..|:|:|..  |.|..:|.:|....||:||  |.....|
 Worm    23 NYTVVRLLGEGGFGAVYLVQDNKSKKQSAMKVERKIEKRKHSKLKMEIAILKLVGSGKHFTQIVD 87

  Fly   122 GIPRIYHLGTCGGR-----YNAMVLELLGLSLEDL-FNICARKFSLKTVLMIAKQLLHRIEYVHS 180
                       .|:     :..:|:||:|.||.|| .:...:.||..|.|.::.|.|..:|.:|.
 Worm    88 -----------RGKKDKEGFFFLVMELVGKSLADLKADRPDKVFSFATGLGVSCQCLEAVEELHK 141

  Fly   181 RHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINT 245
            ...|:||:||:|:..| ...||.. |:|:|||:|::|::.......| ||.....||.|:..|..
 Worm   142 TGFIHRDLKPQNYACG-LDEKRHN-IYILDFGIARKYLNTKNELKTP-RETVGFKGTVRFAPIAC 203

  Fly   246 HMGREQSRRDDLEALGHMFM-YFLRGSLPWQGL--KADTLKERYQKIGDTKRATPIEVLCDGHPE 307
            |...|...:||.|:..::.: ..:...|||:.|  |.:.|||: ::....||::....|  ...:
 Worm   204 HRNTEMGPKDDCESWFYLLLDLIVPSGLPWRKLSDKHEVLKEK-EECRKDKRSSLFAGL--RQTD 265

  Fly   308 EFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDW----TGKTMSTPVGS 362
            ..:..|.|:....:.:..||.|:.:...:.........:..:||    ..||...|..|
 Worm   266 YLSKVLDYIDGRAYQDRVDYQFIYKNLAEACKVCNLDIDSPYDWELQKPEKTSKEPTSS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 83/309 (27%)
S_TKc 62..335 CDD:214567 80/285 (28%)
CK1gamma_C 354..428 CDD:289378 4/9 (44%)
C27D8.1NP_502428.1 PKc_like 23..290 CDD:389743 81/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160798
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.