DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and ZK596.2

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_502028.1 Gene:ZK596.2 / 177983 WormBaseID:WBGene00014007 Length:305 Species:Caenorhabditis elegans


Alignment Length:308 Identity:91/308 - (29%)
Similarity:149/308 - (48%) Gaps:48/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KKIGCGNFGELRL--GKNLYNNEHVAIKMEP-------MKSKAPQLHLEYRFYKLLGSH----AD 117
            ||:|.|.||.:.|  .|.....|: |:|:|.       :|.:...| ||.:..|::|.|    ||
 Worm    23 KKLGEGAFGAVYLVSQKEKPKVEY-ALKVEAESDPLGLLKMEVAVL-LEVKKQKIVGRHFLELAD 85

  Fly   118 NAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDL-----FNICARKFSLKTVLMIAKQLLHRIEY 177
            .           |....::|.||:.|:|.||:||     ||    |||:.|.:.:|:|.|..:|.
 Worm    86 R-----------GNLPQKFNYMVMTLVGKSLQDLRKTAPFN----KFSMGTAISVARQSLEAVED 135

  Fly   178 VHSRHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMS 242
            :|:...::||:||.|:.|||......:.::::|||:|:::...|.....| |......||.:|..
 Worm   136 LHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNP-RARAGFRGTVKYAP 199

  Fly   243 INTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTK---RATPIEVLCDG 304
            :..|:.|||.|:||:|:..:|.:....|.|||:.|...      ..:|..|   :.|.:..|..|
 Worm   200 LACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTES------DDVGVFKKECKTTRLRCLFGG 258

  Fly   305 HPEEFATYLRYVRRLDFFETPDYDFLRRLFQD-LFDRKGYTDEGEFDW 351
            .|.||......:.:..||:.|:|..:..|.:. :.:.|  ::|..:||
 Worm   259 CPREFTEVFPILDKGKFFDAPEYTTIYELLEKAMVNTK--SNEFPYDW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 91/308 (30%)
S_TKc 62..335 CDD:214567 87/289 (30%)
CK1gamma_C 354..428 CDD:289378
ZK596.2NP_502028.1 STKc_TTBK 18..289 CDD:270919 87/289 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160785
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.