DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and ttbk-4

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_501824.1 Gene:ttbk-4 / 177871 WormBaseID:WBGene00012169 Length:366 Species:Caenorhabditis elegans


Alignment Length:316 Identity:93/316 - (29%)
Similarity:154/316 - (48%) Gaps:48/316 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGELRLGKNLYNNEHV--------------AIKMEPMKSKAPQLHLEYRFYKL 111
            ::::||.|..|.||::.:..::.:.:.|              |||:|.|               :
 Worm    23 DWKIGKTIDEGGFGKVYIATSISDPKKVAALKAESNEIEGGSAIKLEAM---------------I 72

  Fly   112 LGSHADNAPDGIPRIYHLGTCGGR--YNAMVLELLGLSLEDLFN---ICARKFSLKTVLMIAKQL 171
            |.....|.|  :|.|..:..|..|  |..||:.|||.:|..|.:   :....||..|...|..|.
 Worm    73 LNKLNANGP--VPHIPVVHLCAKRKLYCYMVMTLLGRNLRKLKSTNLVVNNGFSRGTWSRIGIQC 135

  Fly   172 LHRIEYVHSRHLIYRDVKPENFLIG-RTSTKREKIIHIIDFGLAKEY--IDLDTNRHIPYREH-- 231
            |:.::|||....|:|||||:|||:| .|.::|.:|:||:|||||:.:  .....|:.|..|..  
 Worm   136 LYALKYVHDNGFIHRDVKPQNFLLGNETDSERARIVHILDFGLARPFAVFHARENKWIARRARGT 200

  Fly   232 KSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRG-SLPWQGLKADTLKERYQKIGDTKRA 295
            ....||.||.|.|.|:.:||.|.||:.:|.::.:....| :||||   .|:.:||.:::   |..
 Worm   201 AEFRGTLRYTSPNVHLRKEQGRVDDVWSLLYVIIELNGGKALPWQ---TDSQRERVEQM---KLN 259

  Fly   296 TPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDW 351
            .|.:|:....|......:.::..||:::.|||..:.:.|..:.:.:..|...::||
 Worm   260 LPAKVVMSNMPACMDKVMPHLASLDYYQRPDYHMIFKCFWQVMENEKITPSSKYDW 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 93/316 (29%)
S_TKc 62..335 CDD:214567 89/297 (30%)
CK1gamma_C 354..428 CDD:289378
ttbk-4NP_501824.1 PKc_like 24..298 CDD:389743 89/296 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160786
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.