DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C49C8.1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_501483.2 Gene:C49C8.1 / 177670 WormBaseID:WBGene00016765 Length:502 Species:Caenorhabditis elegans


Alignment Length:453 Identity:98/453 - (21%)
Similarity:157/453 - (34%) Gaps:171/453 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGEL-RLGKN--------LYNNEHV---AIKME-------PMKSKAPQLHLEY 106
            ::.:..||..|.||:: ::.|:        |.:|..|   |||:|       |..:..|:|    
 Worm    26 DYEIVSKIDEGGFGQVFKVTKDHKTFYAMKLESNFQVGGSAIKLEINVLSQLPKNTVFPEL---- 86

  Fly   107 RFYKLLGSHADNAPDGIPRIYHLGTCGG---RYNAMVLELLGLSLEDLFNICARK-----FSLKT 163
                                    .|||   ||:.:||||||   ::|..:.|:.     ||..|
 Worm    87 ------------------------ICGGKRPRYHFLVLELLG---DNLKALKAQSPNPSVFSDGT 124

  Fly   164 VLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIG--RTSTKREKIIHIIDFGLAKEYI-------- 218
            ...|..|.|:.::.:|....::||:||.||.||  ..|..|.:.:.:.|||||::::        
 Worm   125 WSRIGIQCLYAMKMMHDSGFVHRDIKPSNFAIGYSTASESRSRRVLLFDFGLARKFVKKEKNLAP 189

  Fly   219 -------------------------DLDTNRHIPY------------------------------ 228
                                     ||...|..|.                              
 Worm   190 IVTKKESKISKSKTLPSKGPSTKSKDLKPGRSKPILNRKAEQMKIKKNFNMLIPPKSIDQSQRTA 254

  Fly   229 --------------REHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKA 279
                          |.|....||.:|.|.|.|:..|..|.||:.:|.:|...|. ..|||...:.
 Worm   255 EEKVDDEEFTFRRARPHTDFRGTFQYASPNAHLQLELGRHDDIWSLMYMVAEFF-VELPWTSNEE 318

  Fly   280 DTLKERYQK------IGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLF 338
            ..|:|...:      ..|.|..:.:.....|..:|..   :.::..:::.:|.||.:.:.|:|..
 Worm   319 IALEELKNQSSILRLFSDDKNPSRLTPEMRGQLDEID---KNLKSCNYYSSPKYDIVYQFFKDSM 380

  Fly   339 DRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKGGVAAWPDVPKPGA 401
            .:...|....:||                |.|   .|...:.:.|:|.|.  |.|.:   |||
 Worm   381 TKAKVTWTTPYDW----------------ETI---GKSSEDFSKKSNGKR--AVWEN---PGA 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 87/404 (22%)
S_TKc 62..335 CDD:214567 82/384 (21%)
CK1gamma_C 354..428 CDD:289378 11/48 (23%)
C49C8.1NP_501483.2 PKc_like 27..377 CDD:389743 82/384 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.