DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C39H7.1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_500837.1 Gene:C39H7.1 / 177341 WormBaseID:WBGene00016541 Length:308 Species:Caenorhabditis elegans


Alignment Length:300 Identity:79/300 - (26%)
Similarity:135/300 - (45%) Gaps:33/300 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VGKKIGCGNFGEL-----RLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGI 123
            :.||:|.|.||.:     ..||       .|:|:|....:...|.||......|....:.   ..
 Worm    19 IEKKLGEGGFGAVYRVFDATGK-------YAMKVEGANEQIQVLKLEVSVLNELSKRGNR---HF 73

  Fly   124 PRIYHLGTCGGRYNAMVLELLGLSLEDLFNI-CARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRD 187
            .:|...|.. |.:|.:|:.|:|.||:||... .....|:...:.|..|.|..:|.:|:...::||
 Worm    74 CKIEDKGRF-GNFNYVVMTLVGKSLQDLNKAGVGGHMSMGCSIGIGIQSLEALEDLHNIGYLHRD 137

  Fly   188 VKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQS 252
            |||.|:.|||......:.::|:|||:.:::...|.....| |:.....||.:|..|:.|:.||..
 Worm   138 VKPGNYTIGRPELNEIRKVYILDFGMCRKFTGNDGTIRKP-RQAAGFRGTVKYAPISCHLQRELC 201

  Fly   253 RRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRA------TPIEVLCDGHPEEFAT 311
            |:||||...:|.:....|::|||.:      ....::|..|:|      |.....|   |::|..
 Worm   202 RKDDLETWMYMQVELSHGTIPWQHI------SDMNQVGQAKQAIRNNLGTLFPPPC---PQQFQD 257

  Fly   312 YLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDW 351
            .:|.|..:.:::.|:|..:..:.:..:...|..:...:||
 Worm   258 IMRMVDAMKYYDAPNYQAIYGMMRQAYGACGSNENAPYDW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 78/299 (26%)
S_TKc 62..335 CDD:214567 76/282 (27%)
CK1gamma_C 354..428 CDD:289378
C39H7.1NP_500837.1 STKc_TTBK 16..281 CDD:270919 76/282 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.