DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and kin-19

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001369852.1 Gene:kin-19 / 175524 WormBaseID:WBGene00002202 Length:341 Species:Caenorhabditis elegans


Alignment Length:298 Identity:154/298 - (51%)
Similarity:207/298 - (69%) Gaps:12/298 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPD 121
            :|...:::.:|||.|:||::.:..|:.|.|.||||:|..:::.|||..|.:.|::|....     
 Worm    11 IVATKYKLIRKIGSGSFGDIYVSINVTNGEEVAIKLESNRARHPQLLYESKVYRILQGGV----- 70

  Fly   122 GIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYR 186
            |||.|...|| ...||.:|::|||.|||||||.|:|:|::|||||:|.|::.||||||.::.|:|
 Worm    71 GIPHIRWYGT-EREYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMIGRIEYVHVKNFIHR 134

  Fly   187 DVKPENFL--IGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGR 249
            |:||:|||  |||...|    :.:|||||||:|.|..|..||||||.|:|||||||.|||.|:|.
 Worm   135 DIKPDNFLMGIGRHCNK----LFLIDFGLAKKYRDSRTRTHIPYREDKNLTGTARYASINAHLGI 195

  Fly   250 EQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLR 314
            |||||||:|:||::.|||.||:||||||||.|.|::|:||.:.|..|.:|.||.|.|.||..||.
 Worm   196 EQSRRDDMESLGYVLMYFNRGTLPWQGLKAATKKQKYEKISEKKMTTSVEHLCKGFPAEFPMYLS 260

  Fly   315 YVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT 352
            |.|.|.|.|:|||.:||:||:.||....:..:..||||
 Worm   261 YTRGLRFDESPDYMYLRQLFRILFRTLNHQYDYTFDWT 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 153/294 (52%)
S_TKc 62..335 CDD:214567 146/274 (53%)
CK1gamma_C 354..428 CDD:289378
kin-19NP_001369852.1 STKc_CK1_alpha 15..280 CDD:271030 145/274 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.