DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and K09E4.1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_496952.1 Gene:K09E4.1 / 175067 WormBaseID:WBGene00010719 Length:367 Species:Caenorhabditis elegans


Alignment Length:212 Identity:50/212 - (23%)
Similarity:81/212 - (38%) Gaps:32/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIYRDVKPENFLIGRTSTKREKIIHII 209
            |.:||..|.: ..||:|.|...:|:.:|:.|...|....:.|::...:|.....|    :.:.:.
 Worm   139 GPTLEQCFAM-RNKFTLGTAGRLAEDVLNVIRCAHKHGYLVRNMDLNSFHYDAAS----RHLFMA 198

  Fly   210 DFGLAKEYIDLDTNRHIPYREHKSLTGTARY--MSINTHMGREQSRRDDLEALGHMFMYFLRGSL 272
            |.....:.|..|....|     .|..|...|  .|.:..:|    .|.|||...:..::.:.|.|
 Worm   199 DISSLVKNISGDDGAPI-----ASYAGCLDYAPCSDDGLVG----ARQDLETWFYQLVHLVLGEL 254

  Fly   273 PWQGL---KADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYV--RRLDFFETPDYDFLRR 332
            ||..|   :|...|..:||   :|....:       ||.|......|  :.....|..:|..|..
 Worm   255 PWGSLSREEAGVKKAEFQK---SKEFAEL-------PEVFHKIAEVVIAKEYSVVEEEEYVKLAG 309

  Fly   333 LFQDLF-DRKGYTDEGE 348
            |.:.:: :..|.||..|
 Worm   310 LTEQIYKELGGVTDHEE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 50/212 (24%)
S_TKc 62..335 CDD:214567 46/196 (23%)
CK1gamma_C 354..428 CDD:289378
K09E4.1NP_496952.1 PKc_like <132..291 CDD:304357 41/175 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.