DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and Y39G8C.2

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_496946.1 Gene:Y39G8C.2 / 175061 WormBaseID:WBGene00012731 Length:276 Species:Caenorhabditis elegans


Alignment Length:272 Identity:88/272 - (32%)
Similarity:133/272 - (48%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPM--KSKAPQLHLEYRFYKLLGS--HADNAPD 121
            |:.|.:.:|.|.||.:.|.|:...|:..|:|:|..  |.|..:|.:|....||:|:  |.....|
 Worm    23 NYVVSRLLGEGGFGAVYLVKDTKTNKTFAMKVEQKMEKRKHSKLKMEIAILKLVGAGKHFTQIVD 87

  Fly   122 GIPRIYHLGTCGGR-----YNAMVLELLGLSLEDLFNICA-RKFSLKTVLMIAKQLLHRIEYVHS 180
                       .|:     |..:|:||:|.||.||.|..| |.||..|.|.:|.|.|..:|.:|.
 Worm    88 -----------RGKKDKEGYFFLVMELVGKSLGDLKNERAERVFSFGTGLGVASQCLEAVEDLHR 141

  Fly   181 RHLIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINT 245
            ...|:||:||:|:..| ...||.. |:|:|||:|::|::.......| ||.....||.|:..:..
 Worm   142 TGFIHRDLKPQNYACG-LDEKRHN-IYILDFGIARKYLNTKNELKTP-REAVGFKGTVRFAPLAC 203

  Fly   246 HMGREQSRRDDLEALGHMFMYFL--RGSLPWQGL--KADTLKERYQKIGDTKRATPIEVLCDG-- 304
            |...|...|||.|:..::.:..:  || |||:.:  |.:.|||: ::....||    :.|..|  
 Worm   204 HRFTELGPRDDCESWFYLLLDLILPRG-LPWRKMNEKGEVLKEK-EECRKEKR----DKLFYGIK 262

  Fly   305 HPEEFATYLRYV 316
            |..|....|.|:
 Worm   263 HASELNKILDYI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 88/272 (32%)
S_TKc 62..335 CDD:214567 87/271 (32%)
CK1gamma_C 354..428 CDD:289378
Y39G8C.2NP_496946.1 PKc_like 23..276 CDD:389743 88/272 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.