DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and C09D4.3

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_491610.1 Gene:C09D4.3 / 172202 WormBaseID:WBGene00015634 Length:406 Species:Caenorhabditis elegans


Alignment Length:302 Identity:91/302 - (30%)
Similarity:142/302 - (47%) Gaps:28/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAPDGI 123
            |..|.:.:|:|.|..|.:.|  :::....||||.|  |.....|.:|.:....:..|     :|:
 Worm    85 GDRFILRQKLGDGAMGHVFL--SIFGGRSVAIKAE--KYSTGMLPMEIKVLLSIRRH-----NGV 140

  Fly   124 P--RIYHLGTCGGRYNAMVLELLGLSLEDLFNICA----RKFSLKTVLMIAKQLLHRIEYVHSRH 182
            .  .|...||....||.|::.:||   :||:.:.|    |.|:|.|...||.:.:..||.:|:..
 Worm   141 HFCDIIDYGTIRREYNYMIISILG---KDLYRLRAEQPTRSFTLNTTTKIALETIEAIEELHNIG 202

  Fly   183 LIYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHM 247
            .:.|||||.||..|:....:.|.|.:.||||||::||.| |:.:..|......||.||.|:..|.
 Worm   203 YLSRDVKPSNFAPGQRDNGQHKTIFMFDFGLAKKFIDRD-NKKLKSRGEVGWRGTVRYGSLQAHK 266

  Fly   248 GREQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTK---RATPIEVLCDGHPEEF 309
            ..:..||||:|...:|.:..|.|.|||:.:...||      :|.:|   |.....:..:..|.:|
 Worm   267 RMDLGRRDDVECWFYMLIEMLVGELPWRHMSDRTL------VGQSKLSIRNESRRLFFNRTPRQF 325

  Fly   310 ATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDW 351
            .|.:..:....|...|:|..|:.|..::.......|..::||
 Worm   326 ETIMDMIDGYSFEIRPEYRHLKALINEIRMENMIPDRCKWDW 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 90/300 (30%)
S_TKc 62..335 CDD:214567 87/281 (31%)
CK1gamma_C 354..428 CDD:289378
C09D4.3NP_491610.1 PKc_like 87..343 CDD:389743 84/274 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.