DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and CSNK1E

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001885.1 Gene:CSNK1E / 1454 HGNCID:2453 Length:416 Species:Homo sapiens


Alignment Length:416 Identity:198/416 - (47%)
Similarity:273/416 - (65%) Gaps:45/416 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP 120
            |.||..:|:|:|||.|:||::.||.|:.:.|.||||:|.:|:|.||||:|.:|||::....    
Human     3 LRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGV---- 63

  Fly   121 DGIPRIYHLGTCG--GRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHL 183
             |||.|   ..||  |.||.||:||||.|||||||.|:|||||||||::|.|::.||||:||::.
Human    64 -GIPSI---KWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNF 124

  Fly   184 IYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMG 248
            |:|||||:|||:|  ..|:..:::||||||||:|.|..|::||||||:|:|||||||.|||||:|
Human   125 IHRDVKPDNFLMG--LGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLG 187

  Fly   249 REQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYL 313
            .|||||||||:||::.|||..||||||||||.|.:::|::|.:.|.:|||||||.|:|.||:|||
Human   188 IEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYL 252

  Fly   314 RYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDR- 377
            .:.|.|.|.:.|||.:||:||::||.|:|::.:..|||.    ....|:.:...:|    :::| 
Human   253 NFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWN----MLKFGAARNPEDV----DRERR 309

  Fly   378 -HNVTAKTNAKGGVA--AWPDVPKPGATLGNL---------TPADR-----HGSVQVVSSTNGE- 424
             |....:.....|.|  |.|..|..|||...|         |||.|     :.|.:.:|..:.| 
Human   310 EHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSPRAISRVDRER 374

  Fly   425 -----LNPDDPTAGHSNTPITQQPEV 445
                 |:...| |..|::.:|.:.||
Human   375 KVSMRLHRGAP-ANVSSSDLTGRQEV 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 168/294 (57%)
S_TKc 62..335 CDD:214567 160/274 (58%)
CK1gamma_C 354..428 CDD:289378 21/97 (22%)
CSNK1ENP_001885.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 164/283 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..416 26/104 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.