DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and CSNK1A1

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001020276.1 Gene:CSNK1A1 / 1452 HGNCID:2451 Length:365 Species:Homo sapiens


Alignment Length:383 Identity:171/383 - (44%)
Similarity:230/383 - (60%) Gaps:63/383 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SVSTTTGVLMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLL 112
            |.|.:....:||..:::.:|||.|:||::.|..|:.|.|.||:|:|..|::.|||..|.:.||:|
Human     3 SSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKIL 67

  Fly   113 GSHADNAPDGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEY 177
            ....     |||.|...|. ...||.:|::|||.|||||||.|:|:|::|||||:|.|::.||||
Human    68 QGGV-----GIPHIRWYGQ-EKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEY 126

  Fly   178 VHSRHLIYRDVKPENFLIG--------------------RTSTKRE------KIIHIIDFGLAKE 216
            ||:::.|:||:||:|||:|                    ..||.::      ..:.:|||||||:
Human   127 VHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKK 191

  Fly   217 YIDLDTNRHIPYREHKSLTGTARYMSINTHMGREQSRRDDLEALGHMFMYFLRGSLPWQGLKADT 281
            |.|..|.:||||||.|:|||||||.|||.|:|.|||||||:|:||::.|||.|.|||||||||.|
Human   192 YRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAAT 256

  Fly   282 LKERYQKIGDTKRATPIEVLCDGHPEEFATYLRYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDE 346
            .|::|:||.:.|.:||:||||.|.|.|||.||.|.|.|.|.|.|||.:||:||:.||....:..:
Human   257 KKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYD 321

  Fly   347 GEFDWT----------------GKTMSTPVGSLQTGHEVIISPNKDRHNVTAKTNAKG 388
            ..||||                |:...||.|. ||          |:    .|:|.||
Human   322 YTFDWTMLKQKAAQQAASSSGQGQQAQTPTGK-QT----------DK----TKSNMKG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 156/334 (47%)
S_TKc 62..335 CDD:214567 149/298 (50%)
CK1gamma_C 354..428 CDD:289378 10/35 (29%)
CSNK1A1NP_001020276.1 STKc_CK1_alpha 16..309 CDD:271030 148/298 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.