DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and CSNK1A1L

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_660204.2 Gene:CSNK1A1L / 122011 HGNCID:20289 Length:337 Species:Homo sapiens


Alignment Length:341 Identity:162/341 - (47%)
Similarity:220/341 - (64%) Gaps:33/341 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP 120
            |:||..:::.:|||.|:||::.||....|.|.||:|:|..|.|.|||..|.:.|.:|....    
Human    11 LVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYESKLYTILQGGV---- 71

  Fly   121 DGIPRIYHLGTCGGRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHLIY 185
             |||.::..|..... |.:|::|||.|||||||.|:|:|::|||||:|.|::.||||||:::.::
Human    72 -GIPHMHWYGQEKDN-NVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLH 134

  Fly   186 RDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMGRE 250
            ||:||:|||:| |.....|:. :|||||||:|.|..|.:||||||.|.|.||.||.|||.|:|.|
Human   135 RDIKPDNFLMG-TGRHCNKLF-LIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIE 197

  Fly   251 QSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYLRY 315
            ||||||:|:||::||||.|.|||||||:|.|.|::|:||.:.|.:||:||||.|.|.|||.||.|
Human   198 QSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNY 262

  Fly   316 VRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWT----------------GKTMSTPVGSLQ 364
            .|.|.|.|.|||.:||:||:.||....:..:..||||                |:...|     |
Human   263 CRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQT-----Q 322

  Fly   365 TGHEVIISPNKDRHNV 380
            ||.:.    .|:::||
Human   323 TGKQT----EKNKNNV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 151/308 (49%)
S_TKc 62..335 CDD:214567 144/272 (53%)
CK1gamma_C 354..428 CDD:289378 7/27 (26%)
CSNK1A1LNP_660204.2 STKc_CK1_alpha 16..281 CDD:271030 143/272 (53%)
SPS1 16..>239 CDD:223589 119/230 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..337 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.