DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gish and csnk1e

DIOPT Version :9

Sequence 1:NP_001262624.1 Gene:gish / 49701 FlyBaseID:FBgn0250823 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_997912.1 Gene:csnk1e / 100006858 ZFINID:ZDB-GENE-030131-7873 Length:417 Species:Danio rerio


Alignment Length:419 Identity:192/419 - (45%)
Similarity:263/419 - (62%) Gaps:56/419 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LMVGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSKAPQLHLEYRFYKLLGSHADNAP 120
            |.||..:|:|:|||.|:||::.||.|:.:.|.||||:|.:|:|.||||:|.:|||::....    
Zfish     3 LRVGSKYRLGRKIGSGSFGDIYLGANITSGEEVAIKLESVKTKHPQLHIESKFYKMMQGGV---- 63

  Fly   121 DGIPRIYHLGTCG--GRYNAMVLELLGLSLEDLFNICARKFSLKTVLMIAKQLLHRIEYVHSRHL 183
             |||.|   ..||  |.||.||:||||.|||||||.|:|||:|||||::|.|::.||||:||::.
Zfish    64 -GIPSI---KWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFTLKTVLLLADQMISRIEYIHSKNF 124

  Fly   184 IYRDVKPENFLIGRTSTKREKIIHIIDFGLAKEYIDLDTNRHIPYREHKSLTGTARYMSINTHMG 248
            |:||:||:|||:|  ..|:..:::||||||||:|.|..|::||||||:|:|||||||.|||||:|
Zfish   125 IHRDIKPDNFLMG--LGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLG 187

  Fly   249 REQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCDGHPEEFATYL 313
            .|||||||||:||::.|||..||||||||||.|.:::|::|.:.|.:|||||||.|.|.||:||:
Zfish   188 IEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGFPSEFSTYM 252

  Fly   314 RYVRRLDFFETPDYDFLRRLFQDLFDRKGYTDEGEFDWTGKTMSTPVGSLQTGHEVIISPNKDRH 378
            .:.|.|.|.:.|||.:||:||::||.|:|::.:..|||.    ....||.:|..|   ...:.|.
Zfish   253 NFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWN----MLKFGSSRTAEE---KEKEQRG 310

  Fly   379 NVTAKTNAKGG---------VAAWPDVPKP-----GATLGNLTPADRHGSVQVVSSTNGELNPDD 429
            ....:....||         :.:.|::|.|     |....:.|||.|     |..|.|.     .
Zfish   311 EGEERDERTGGGPPGSAARALPSGPNLPAPNRVRNGPDPPSSTPASR-----VPQSGNA-----S 365

  Fly   430 PTAG-------------HSNTPITQQPEV 445
            |.||             |...|....|::
Zfish   366 PRAGRGAERERRVCLRLHRGAPANASPDL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gishNP_001262624.1 STKc_CK1_gamma 61..354 CDD:271028 165/294 (56%)
S_TKc 62..335 CDD:214567 157/274 (57%)
CK1gamma_C 354..428 CDD:289378 18/87 (21%)
csnk1eNP_997912.1 SPS1 8..360 CDD:223589 181/373 (49%)
STKc_CK1_delta_epsilon 8..282 CDD:271027 161/283 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.