DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gng13 and Ggamma30A

DIOPT Version :9

Sequence 1:NP_001011028.1 Gene:gng13 / 496437 XenbaseID:XB-GENE-1015594 Length:67 Species:Xenopus tropicalis
Sequence 2:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster


Alignment Length:67 Identity:30/67 - (44%)
Similarity:44/67 - (65%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


 Frog     1 MDEMDAPQMKKEVESLKYQLAYKREMCSKSIPELLKWIEDGVPNDPFLNPELMKNNPWVERGKCS 65
            :..||...:||::|::|||.:.:|...||||.|:..:||:...|||.:|....|||||.|:|||.
  Fly     6 LQNMDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKCV 70

 Frog    66 IL 67
            |:
  Fly    71 IM 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gng13NP_001011028.1 GGL 6..60 CDD:238024 23/53 (43%)
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024 24/55 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9901
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5164
OMA 1 1.010 - - QHG49271
OrthoDB 1 1.010 - - D1597581at2759
OrthoFinder 1 1.000 - - FOG0006416
OrthoInspector 1 1.000 - - oto103932
Panther 1 1.100 - - LDO PTHR15936
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4582
SonicParanoid 1 1.000 - - X4681
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.