DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and osr1

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001008046.1 Gene:osr1 / 493408 XenbaseID:XB-GENE-481410 Length:259 Species:Xenopus tropicalis


Alignment Length:75 Identity:35/75 - (46%)
Similarity:49/75 - (65%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH---- 77
            |...:.|.||:||:|.|.|||.|||:|||||| :.|..|:|::|.|.|:::|:||.||.:|    
 Frog   159 RLPSKTKKEFVCKFCGRHFTKSYNLLIHERTH-TDERPYTCDICHKAFRRQDHLRDHRYIHSKEK 222

  Fly    78 ---MDTCGRG 84
               ...||:|
 Frog   223 PFKCQECGKG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 14/19 (74%)
C2H2 Zn finger 57..77 CDD:275368 9/19 (47%)
osr1NP_001008046.1 zf-C2H2 168..190 CDD:333835 15/21 (71%)
C2H2 Zn finger 170..190 CDD:275368 14/19 (74%)
zf-H2C2_2 182..207 CDD:372612 14/25 (56%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)
zf-H2C2_2 210..233 CDD:372612 8/23 (35%)
C2H2 Zn finger 226..246 CDD:275368 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.