powered by:
Protein Alignment drm and osr1
DIOPT Version :9
Sequence 1: | NP_001285590.1 |
Gene: | drm / 49638 |
FlyBaseID: | FBgn0024244 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001008046.1 |
Gene: | osr1 / 493408 |
XenbaseID: | XB-GENE-481410 |
Length: | 259 |
Species: | Xenopus tropicalis |
Alignment Length: | 75 |
Identity: | 35/75 - (46%) |
Similarity: | 49/75 - (65%) |
Gaps: | 8/75 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 RRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH---- 77
|...:.|.||:||:|.|.|||.|||:|||||| :.|..|:|::|.|.|:::|:||.||.:|
Frog 159 RLPSKTKKEFVCKFCGRHFTKSYNLLIHERTH-TDERPYTCDICHKAFRRQDHLRDHRYIHSKEK 222
Fly 78 ---MDTCGRG 84
...||:|
Frog 223 PFKCQECGKG 232
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000748 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.